JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112273

Recombinant Human COX IV protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human COX IV protein is a Human protein, in the 1 to 169 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

COX4, COX4I1, Cytochrome c oxidase polypeptide IV, Cytochrome c oxidase subunit IV isoform 1, COX IV-1

1 Images
SDS-PAGE - Recombinant Human COX IV protein (AB112273)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human COX IV protein (AB112273)

12.5% SDS-PAGE showing ab112273 at approximately 44.33kDa stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

P13073

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein)</p>" } } }

Sequence info

[{"sequence":"MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK","proteinLength":null,"predictedMolecularWeight":"44.33 kDa","actualMolecularWeight":null,"aminoAcidEnd":169,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P13073","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Cytochrome c oxidase subunit IV commonly known as COX IV is a component of the enzyme complex located in the inner mitochondrial membrane. COX IV has a molecular weight of approximately 17 kDa and serves as a subunit of the larger cytochrome c oxidase complex which is essential in cellular respiration. As a mitochondrial marker COX IV is expressed in various tissues where it acts as an important player in the electron transport chain. The presence and function of COX IV are critical in facilitating the last step of the mitochondrial respiratory chain.
Biological function summary

COX IV acts as a significant part of the cytochrome c oxidase complex helping catalyze the reduction of oxygen to water. This process is an important step in the overall mechanism of oxidative phosphorylation. COX IV's role in this complex enables the proton gradient generation across the inner mitochondrial membrane which is necessary for ATP synthesis. Its activity regulates the efficiency of cellular respiration impacting energy production and metabolic activities within cells.

Pathways

COX IV functionally interacts within the oxidative phosphorylation and electron transport chain pathways. Its coordination with other proteins like COX I and COX II in the cytochrome c oxidase complex ensures proper electron transfer to oxygen. Additionally COX IV is implicated in the regulation of reactive oxygen species maintaining cellular homeostasis. These pathways interconnect with broader cellular mechanisms that involve energy metabolism and apoptosis.

COX IV has been linked to mitochondrial disorders where defects in the oxidative phosphorylation processes can lead to conditions such as mitochondrial encephalomyopathy. Abnormalities in COX IV function and expression can also contribute to neurodegenerative diseases including Parkinson's disease. Here interactions with proteins like superoxide dismutase (SOD) highlight how oxidative stress and mitochondrial dysfunction relate closely to disease progression. These associations underline the importance of COX IV in maintaining cellular and organismal health.

Specifications

Form

Liquid

General info

Function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Sequence similarities

Belongs to the cytochrome c oxidase IV family.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
See full target information COX4I1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com