JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198643

Recombinant human COX1 / Cyclooxygenase 1 protein (DDDDK tag C-Terminus + His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human COX1 / Cyclooxygenase 1 protein (DDDDK tag C-Terminus + His tag C-Terminus) is a Human Full Length protein, in the 1 to 599 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE, FuncS.

View Alternative Names

COX1, PTGS1, Prostaglandin G/H synthase 1, Cyclooxygenase-1, Prostaglandin H2 synthase 1, Prostaglandin-endoperoxide synthase 1, COX-1, PGH synthase 1, PGHS-1, PHS 1

2 Images
Functional Studies - Recombinant human COX1 / Cyclooxygenase 1 protein (DDDDK tag C-Terminus + His tag C-Terminus) (AB198643)
  • FuncS

Supplier Data

Functional Studies - Recombinant human COX1 / Cyclooxygenase 1 protein (DDDDK tag C-Terminus + His tag C-Terminus) (AB198643)

Mixed various concentrations of enzyme in Assay buffer (100 mM Tris-HCl pH 8, 3 μM EDTA) with 5 μM Hematin for 10 min then added 100 μM Ampliflu Red and 200 μM arachidonic acid. Fluorescence (ex. 535 em. 590) was measured after 5 minutes at room temperature. Reaction volume was 100 μl.

SDS-PAGE - Recombinant human COX1 / Cyclooxygenase 1 protein (DDDDK tag C-Terminus + His tag C-Terminus) (AB198643)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human COX1 / Cyclooxygenase 1 protein (DDDDK tag C-Terminus + His tag C-Terminus) (AB198643)

4-20% SDS-PAGE analysis of 1.2 μg ab198643 with Coomassie staining.

Key facts

Purity

>90% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

DDDDK tag C-Terminus His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Mixed various concentrations of enzyme in Assay buffer (100 mM Tris-HCl pH 8, 3 μM EDTA) with 5 μM Hematin for 10 min
then added 100 μM Ampliflu Red and 200 μM arachidonic acid. Fluorescence (ex. 535 em. 590) was measured after 5
minutes at room temperature. Reaction volume was 100 μl. Application: Useful for the study of enzyme kinetics, screening inhibitors and selectivity profiling.

Accession

P23219

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.08% Triton X-100, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride, 0.0067% Sodium diethyldithiocarbamate trihydrate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

REACH authorisation
Abcam has not and does not intend to apply for the REACH Authorisation of customers' uses of products that contain European Authorisation list (Annex XIV) substances.
It is the responsibility of our customers to check the necessity of application of REACH Authorisation, and any other relevant authorisations, for their intended uses.

Sequence info

[{"sequence":"MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTELDYKDDDDKHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"70.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":599,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P23219","tags":[{"tag":"DDDDK","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Cyclooxygenase 1 (COX-1) also known as COX1 cyclooxygenase-1 COX one and the COX1 protein is an important enzyme in the conversion of arachidonic acid to prostaglandins. It is a heme-containing dimer enzyme with a molecular weight of approximately 70 kDa. COX-1 is widely expressed in most tissues and cell types where it plays a significant role in maintaining homeostatic functions. This protein is constitutively active meaning it is often active under normal physiological conditions.
Biological function summary

COX-1 is involved in producing prostaglandins that regulate a variety of normal physiological processes including gastric mucosal protection renal blood flow and platelet aggregation. Unlike COX-2 COX-1 is not induced by inflammatory stimuli and is not part of an inducible complex. It serves to maintain essential physiological functions in various organs and systems making its activity critical for cellular maintenance.

Pathways

COX-1 is primarily involved in the prostaglandin biosynthesis pathway. It converts arachidonic acid into prostaglandin H2 a precursor for other prostaglandins and thromboxanes. Thromboxane A2 produced from this pathway plays an important role in platelet aggregation and vasoconstriction linking COX-1's functions with hemostatic processes. Another protein involved in this pathway is thromboxane synthase which further processes the products of COX-1 activity.

COX-1’s role connects it closely to conditions like peptic ulcers and cardiovascular diseases. Inhibition of COX-1 by nonsteroidal anti-inflammatory drugs (NSAIDs) can lead to gastric mucosal damage contributing to the development of peptic ulcers. Additionally due to its involvement in platelet aggregation COX-1 affects thrombotic diseases. COX-1's interactions with proteins such as COX-2 become relevant in inflammation and pain management where selective inhibition of COX-2 is sought to reduce adverse effects related to COX-1.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Dual cyclooxygenase and peroxidase that plays an important role in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate, AA, C20 : 4(n-6)), with a particular role in the inflammatory response. The cyclooxygenase activity oxygenates AA to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide prostaglandin H2 (PGH2), the precursor of all 2-series prostaglandins and thromboxanes. This complex transformation is initiated by abstraction of hydrogen at carbon 13 (with S-stereochemistry), followed by insertion of molecular O2 to form the endoperoxide bridge between carbon 9 and 11 that defines prostaglandins. The insertion of a second molecule of O2 (bis-oxygenase activity) yields a hydroperoxy group in PGG2 that is then reduced to PGH2 by two electrons (PubMed : 7947975). Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells (Probable). Can also use linoleate (LA, (9Z,12Z)-octadecadienoate, C18 : 2(n-6)) as substrate and produce hydroxyoctadecadienoates (HODEs) in a regio- and stereospecific manner, being (9R)-HODE ((9R)-hydroxy-(10E,12Z)-octadecadienoate) and (13S)-HODE ((13S)-hydroxy-(9Z,11E)-octadecadienoate) its major products (By similarity).

Sequence similarities

Belongs to the prostaglandin G/H synthase family.

Product protocols

Target data

Dual cyclooxygenase and peroxidase that plays an important role in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate, AA, C20 : 4(n-6)), with a particular role in the inflammatory response. The cyclooxygenase activity oxygenates AA to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide prostaglandin H2 (PGH2), the precursor of all 2-series prostaglandins and thromboxanes. This complex transformation is initiated by abstraction of hydrogen at carbon 13 (with S-stereochemistry), followed by insertion of molecular O2 to form the endoperoxide bridge between carbon 9 and 11 that defines prostaglandins. The insertion of a second molecule of O2 (bis-oxygenase activity) yields a hydroperoxy group in PGG2 that is then reduced to PGH2 by two electrons (PubMed : 7947975). Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells (Probable). Can also use linoleate (LA, (9Z,12Z)-octadecadienoate, C18 : 2(n-6)) as substrate and produce hydroxyoctadecadienoates (HODEs) in a regio- and stereospecific manner, being (9R)-HODE ((9R)-hydroxy-(10E,12Z)-octadecadienoate) and (13S)-HODE ((13S)-hydroxy-(9Z,11E)-octadecadienoate) its major products (By similarity).
See full target information PTGS1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com