JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB139199

Recombinant Human COX5A protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human COX5A protein (His tag N-Terminus) is a Human Full Length protein, in the 42 to 150 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Cytochrome c oxidase polypeptide Va, COX5A

1 Images
SDS-PAGE - Recombinant Human COX5A protein (His tag N-Terminus) (AB139199)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human COX5A protein (His tag N-Terminus) (AB139199)

15% SDS-PAGE analysis of ab139199 (3ug)

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P20674

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV","proteinLength":"Full Length","predictedMolecularWeight":"14.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":150,"aminoAcidStart":42,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P20674","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

COX5A also known as Cytochrome c oxidase subunit 5A plays a role in the electron transport chain which is essential in cellular respiration. This protein has a mass of about 17 kDa and is part of the mitochondrial inner membrane. COX5A is expressed in most tissues given its importance in energy production. It is homologous across species indicating evolutionary conservation and a fundamental biological role.
Biological function summary

COX5A functions as a component of the cytochrome c oxidase complex also known as Complex IV in the mitochondrial electron transport chain. This complex catalyzes the reduction of oxygen to water facilitating ATP synthesis by oxidative phosphorylation. The assembly of cytochrome c oxidase involves several subunits and COX5A contributes to the structural integrity and regulation of this complex. It helps maintain efficient electron flow and energy conversion supporting high-energy demand processes within cells.

Pathways

COX5A is an important player in the oxidative phosphorylation pathway. This pathway is critical for ATP production linking electron transfer with proton transport and chemiosmotic coupling. COX5A interacts with proteins like cytochrome c and other subunits of Complex IV to ensure proper function and energy conversion. The protein is also involved in cellular responses to hypoxia where it helps modulate oxygen utilization.

COX5A has connections to conditions related to impaired energy metabolism such as mitochondrial disorders like MELAS syndrome. Defects or insufficiencies in COX5A contribute to decreased mitochondrial function impacting tissues with high metabolic rates. The protein also relates to neurodegenerative diseases through its effect on mitochondrial stability and function. Its activity may influence disease progression by interacting with proteins that regulate mitochondrial dynamics such as others in the electron transport chain.

Specifications

Form

Liquid

Additional notes

ab139199 is purified using conventional chromatography techniques.

General info

Function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Sequence similarities

Belongs to the cytochrome c oxidase subunit 5A family.

Post-translational modifications

In response to mitochondrial stress, the precursor protein is ubiquitinated by the SIFI complex in the cytoplasm before mitochondrial import, leading to its degradation (PubMed:38297121). Within the SIFI complex, UBR4 initiates ubiquitin chain that are further elongated or branched by KCMF1 (PubMed:38297121).

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
See full target information Cytochrome c oxidase subunit 5A, mitochondrial

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com