JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167859

Recombinant Human COX5B protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human COX5B protein is a Human Full Length protein, in the 32 to 129 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Cytochrome c oxidase polypeptide Vb, COX5B

1 Images
SDS-PAGE - Recombinant Human COX5B protein (AB167859)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human COX5B protein (AB167859)

15% SDS-PAGE analysis of ab167859 (3µg).

Note : Molecular weight on SDS-PAGE will appear higher.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P10606

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris-HCl buffer, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH","proteinLength":"Full Length","predictedMolecularWeight":"13 kDa","actualMolecularWeight":null,"aminoAcidEnd":129,"aminoAcidStart":32,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P10606","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target COX5B also known as cytochrome c oxidase subunit 5B is a subunit of the cytochrome c oxidase (complex IV) in mitochondria. This protein has a mass of approximately 13.2 kDa and plays an essential role in the electron transport chain. COX5B aids in the terminal step of the mitochondrial respiratory chain by facilitating electron transfer from reduced cytochrome c to oxygen. This process occurs mainly in mitochondria-rich tissues such as muscles neurons and cardiac muscle where high energy demand exists.
Biological function summary

COX5B acts within the larger cytochrome c oxidase complex which consists of multiple subunits that work together to promote efficient oxidative phosphorylation. This subunit contributes to the enzymatic activity that pumps protons across the inner mitochondrial membrane a critical step for ATP synthesis. The operation of COX5B is important for cellular respiration and energy production impacting metabolic functions across various cell types. It maintains cellular energy homeostasis by regulating how efficiently cells convert nutrients into energy.

Pathways

COX5B plays an important role in the oxidative phosphorylation pathway and is a part of the electron transport chain (ETC). It interacts with other ETC proteins such as COX2 and COX3 to ensure the proper function of the chain. Furthermore COX5B's involvement in oxidative phosphorylation links it to pathways like ATP synthesis where it indirectly influences essential cellular processes such as apoptosis and cellular metabolism due to its role in energy production.

COX5B has associations with conditions involving mitochondrial dysfunction such as mitochondrial myopathy and mitochondrial encephalomyopathy. Alterations in COX5B expression or function might disrupt the electron transport chain compromising ATP production. These conditions often coexist with mutations or dysregulation in other mitochondrial proteins such as COX6A1 which indicate a broader spectrum of mitochondrial disorders. Understanding COX5B's role in such diseases could lead to insights into potential therapeutic targets for mitochondrial-related disorders.

Specifications

Form

Liquid

Additional notes

ab167859 is purified using conventional chromatography techniques

General info

Function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Sequence similarities

Belongs to the cytochrome c oxidase subunit 5B family.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
See full target information Cytochrome c oxidase subunit 5B, mitochondrial

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com