JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114917

Recombinant Human COX6B1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human COX6B1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 87 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

COX6B, COX6B1, Cytochrome c oxidase subunit 6B1, Cytochrome c oxidase subunit VIb isoform 1, COX VIb-1

1 Images
SDS-PAGE - Recombinant Human COX6B1 protein (GST tag N-Terminus) (AB114917)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human COX6B1 protein (GST tag N-Terminus) (AB114917)

12.5% SDS-PAGE showing ab114917 at approximately 35.20kDa.
Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

P14854

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Recombinant protein.</p>" } } }

Product details

This product was previously labelled as Cytochrome C Oxidase subunit Vib.

Sequence info

[{"sequence":"MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI","proteinLength":"Full Length","predictedMolecularWeight":"35.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":87,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P14854","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

COX6B1 also called Cytochrome c oxidase subunit 6B1 is an integral part of the cytochrome c oxidase (complex IV) of the mitochondrial electron transport chain. This protein weighs approximately 11 kDa. It is expressed in various tissues with higher expression in heart and muscle tissues. COX6B1 acts as a connecting unit between two core components of the cytochrome c oxidase secure the assembly and stability of the complex.
Biological function summary

The COX6B1 protein plays an important role in the electron transport chain by facilitating the transfer of electrons from cytochrome c to oxygen. It helps in efficient energy production by contributing to the proton gradient used in ATP synthesis. As part of the cytochrome c oxidase complex COX6B1 works with other subunits to enable cellular respiration. Its stability is important for maintaining the proper function and formation of the cytochrome c oxidase complex.

Pathways

The electron transport chain is the primary pathway where COX6B1 operates. It is involved in oxidative phosphorylation a critical process for energy production in cells. Through this pathway COX6B1 interacts with other proteins such as cytochrome c and other subunits of cytochrome c oxidase like COX2 and COX4 which are part of the same complex. These interactions ensure the efficiency of ATP generation from ADP.

Mutations or dysfunctions in the COX6B1 gene can lead to mitochondrial conditions such as Complex IV deficiency and Leigh syndrome. These conditions often result in energy production deficits and neurological impairment. COX6B1 is linked to other proteins like COX4 which when mutated can also contribute to similar mitochondrial disorders. Identifying changes in COX6B1 can provide insights into mitochondrial pathologies and potential therapeutic targets.

Specifications

Form

Liquid

General info

Function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Sequence similarities

Belongs to the cytochrome c oxidase subunit 6B family.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
See full target information COX6B1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com