JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271467

Recombinant Human CRBN + DDB1 + CUL-4A + RBX1 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CRBN + DDB1 + CUL-4A + RBX1 protein (Tagged) is a Human Full Length protein, in the 1 to 1140 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE, FuncS.

View Alternative Names

RNF75, ROC1, RBX1, E3 ubiquitin-protein ligase RBX1, E3 ubiquitin-protein transferase RBX1, Protein ZYP, RING finger protein 75, RING-box protein 1, Regulator of cullins 1, Rbx1

2 Images
Functional Studies - Recombinant Human CRBN + DDB1 + CUL-4A + RBX1 protein (Tagged) (AB271467)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human CRBN + DDB1 + CUL-4A + RBX1 protein (Tagged) (AB271467)

Cereblon-BRD3 interaction.

Various amounts of ab271467 were incubated in 10-ul reaction with dBET1 and GST-BRD3(BD2) at room temperature for one hour. After this, FLAG-acceptor beads and GSH-donor beads were added followed by detection of A-counts.

SDS-PAGE - Recombinant Human CRBN + DDB1 + CUL-4A + RBX1 protein (Tagged) (AB271467)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CRBN + DDB1 + CUL-4A + RBX1 protein (Tagged) (AB271467)

SDS-PAGE analysis of ab271467.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Cereblon-BRD3 interaction was assessed using A-screen technology. Various amounts of ab271467 were incubated in 10-ul reaction with dBET1 and GST-BRD3(BD2) at room temperature for one hour. After this, FLAG-acceptor beads and GSH-donor beads were added followed by detection of A-counts.

Accession

P62877

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Co-expressed in HEK-293 cells.

Sequence info

[{"sequence":"MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH","proteinLength":"Full Length","predictedMolecularWeight":"128 kDa","actualMolecularWeight":null,"aminoAcidEnd":1140,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q16531","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]},{"sequence":"AAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":108,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P62877","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"AGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL","proteinLength":"Full Length","predictedMolecularWeight":"51 kDa","actualMolecularWeight":null,"aminoAcidEnd":442,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q96SW2","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]},{"sequence":"ADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAGNKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA","proteinLength":"Full Length","predictedMolecularWeight":"88 kDa","actualMolecularWeight":null,"aminoAcidEnd":729,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q13619","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The DDB1-CUL4A-RBX1-CRBN complex often referred to simply as CRBN complex plays a core role in targeting proteins for ubiquitination and proteasomal degradation. DDB1 (damage-specific DNA binding protein 1) and CRBN (cereblon) contribute importantly to the functionality of this complex. DDB1 protein weighs about 127 kDa. CRBN is an important component with a mass of about 51 kDa. This complex is highly expressed in various human tissues including the brain liver and lungs. The complex serves as an E3 ubiquitin ligase controlling protein homeostasis.
Biological function summary

The DDB1 CRBN and associated proteins interact closely in the ubiquitin-proteasome system functioning as a part of the larger cullin-RING ligase complex. It acts by recognizing and binding target proteins tagging them for degradation which mediates cellular processes such as DNA repair cell cycle and apoptosis. DDB1 acts as an adaptor that recruits substrate-specific receptors and CRBN often serves as a specificity factor within the protein assembly.

Pathways

The DDB1-CRBN complex intricately integrates into the ubiquitin-proteasome pathway and the cell cycle regulation pathway. It is important for the removal of misfolded or damaged proteins preventing protein aggregation. It interacts with proteins such as c-JUN and MDM2 which link it to cell cycle regulation and stress response pathways. This complex functions in substrate recognition and subsequent degradation to maintain cellular equilibrium.

The dysfunction or deregulation of the DDB1-CUL4A-RBX1-CRBN system associates with cancers and certain neurodegenerative diseases. In hematological malignancies improper CRBN function affects protein homeostasis contributing to disease progression. CRBN is also implicated in certain forms of cognitive dysfunctions where its disrupted function affects neurological signaling pathways. Therapeutic strategies often target this complex indirectly highlighting its potential role in disease treatment alongside proteins like p53 and Cyclin E.

Specifications

Form

Liquid

General info

Function

E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair (PubMed : 10230407, PubMed : 10579999, PubMed : 11961546, PubMed : 15983046, PubMed : 16678110, PubMed : 19112177, PubMed : 19679664, PubMed : 22748924, PubMed : 23455478, PubMed : 27565346, PubMed : 29769719, PubMed : 33417871, PubMed : 38326650). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (PubMed : 27565346). The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex promotes the ubiquitination of ERCC6 resulting in proteasomal degradation. Core component of the Cul7-RING(FBXW8) ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 35982156). Core component of a Cul9-RING ubiquitin ligase complex composed of CUL9 and RBX1, which mediates mono-ubiquitination of p53/TP53 (PubMed : 38605244). Recruits the E2 ubiquitin-conjugating enzyme CDC34 to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. As part of a multisubunit complex composed of elongin BC complex (ELOB and ELOC), elongin A/ELOA, RBX1 and CUL5; polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177).

Sequence similarities

Belongs to the RING-box family.

Subcellular localisation

Nucleus

Product protocols

Target data

E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair (PubMed : 10230407, PubMed : 10579999, PubMed : 11961546, PubMed : 15983046, PubMed : 16678110, PubMed : 19112177, PubMed : 19679664, PubMed : 22748924, PubMed : 23455478, PubMed : 27565346, PubMed : 29769719, PubMed : 33417871, PubMed : 38326650). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (PubMed : 27565346). The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex promotes the ubiquitination of ERCC6 resulting in proteasomal degradation. Core component of the Cul7-RING(FBXW8) ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 35982156). Core component of a Cul9-RING ubiquitin ligase complex composed of CUL9 and RBX1, which mediates mono-ubiquitination of p53/TP53 (PubMed : 38605244). Recruits the E2 ubiquitin-conjugating enzyme CDC34 to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. As part of a multisubunit complex composed of elongin BC complex (ELOB and ELOC), elongin A/ELOA, RBX1 and CUL5; polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177).
See full target information RBX1

Additional targets

CRBN,DDB1,Cullin-4A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com