JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB111636

Recombinant Human CRCP protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CRCP protein is a Human Full Length protein, in the 1 to 148 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

DNA-directed RNA polymerase III subunit RPC9, RNA polymerase III subunit C9, Calcitonin gene-related peptide-receptor component protein, CGRP-RCP, CGRP-receptor component protein, CGRPRCP, HsC17, CRCP

1 Images
SDS-PAGE - Recombinant Human CRCP protein (AB111636)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CRCP protein (AB111636)

15% SDS-PAGE showing ab111636 at approximately 19.0kDa (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

O75575

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA","proteinLength":"Full Length","predictedMolecularWeight":"19 kDa","actualMolecularWeight":null,"aminoAcidEnd":148,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O75575","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target CRCP also known as CGRP receptor component protein is a protein with a mass of approximately 148 kDa. It has a mechanical role in assisting the function of calcitonin gene-related peptide (CGRP) receptors. CRCP localizes in various tissues including the central nervous system and peripheral tissues like the heart and kidneys. Its expression is important for the proper signaling of peptide hormones in these areas.
Biological function summary

The CRCP influences the efficacy of CGRP receptor signaling. It functions as a part of the receptor complex aiding in the transmission of signals that control vasodilation and neuronal communication. CRCP does not act alone often associating with other components such as receptor activity-modifying proteins (RAMPs) and calcitonin receptor-like receptors (CLR) forming a fully functional CGRP receptor complex. This complex regulates important processes like blood flow and neurotransmitter release.

Pathways

CRCP participates in pathways related to neurovascular and endocrine signaling. It plays a role in the CGRP signaling pathway which involves significant proteins such as RAMP1 and CLR. These pathways contribute to the regulation of blood vessel tone and neuropeptide release impacting various physiological responses. CRCP's role in these pathways highlights its importance in maintaining proper cardiovascular and nervous system functioning.

CRCP is involved with migraine and cardiovascular diseases. Aberrations in CRCP or its associated signaling pathways may lead to dysregulation contributing to migraine pathophysiology. The protein's interaction with CGRP is well-documented in these conditions where the overactivation of the CGRP pathway can exacerbate symptoms. Moreover since CRCP is part of the vascular regulation mechanism any disruption in its function might contribute to cardiovascular disorders indicating a significant therapeutic target in these diseases.

Specifications

Form

Liquid

Additional notes

qb111636 was purified using conventional chromatography techniques.

General info

Function

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (PubMed : 20413673, PubMed : 33558764, PubMed : 34675218). Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci. With POLR3H/RPC8 forms a mobile stalk that protrudes from Pol III core and functions primarily in transcription initiation (By similarity) (PubMed : 20413673, PubMed : 33558764, PubMed : 33558766, PubMed : 34675218). Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway (PubMed : 19609254, PubMed : 19631370).. Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.

Sequence similarities

Belongs to the eukaryotic RPC9 RNA polymerase subunit family.

Subcellular localisation

Nucleus

Product protocols

Target data

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (PubMed : 20413673, PubMed : 33558764, PubMed : 34675218). Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci. With POLR3H/RPC8 forms a mobile stalk that protrudes from Pol III core and functions primarily in transcription initiation (By similarity) (PubMed : 20413673, PubMed : 33558764, PubMed : 33558766, PubMed : 34675218). Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway (PubMed : 19609254, PubMed : 19631370).. Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.
See full target information CRCP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com