JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276490

Recombinant Human CREB3L1/OASIS protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CREB3L1/OASIS protein (His tag) is a Human Fragment protein, in the 396 to 519 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

OASIS, PSEC0238, CREB3L1, Cyclic AMP-responsive element-binding protein 3-like protein 1, cAMP-responsive element-binding protein 3-like protein 1, Old astrocyte specifically-induced substance

1 Images
SDS-PAGE - Recombinant Human CREB3L1/OASIS protein (His tag) (AB276490)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CREB3L1/OASIS protein (His tag) (AB276490)

SDS-PAGE analysis of ab276490

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q96BA8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EFSSGSQTVKEDPLAADGVYTASQMPSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTKYLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS","proteinLength":"Fragment","predictedMolecularWeight":"15.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":519,"aminoAcidStart":396,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q96BA8","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CREB3L1 also known as OASIS is a transcription factor with a significant role in various cellular functions. It belongs to the CREB/ATF family and has a molecular mass of approximately 55 kDa. This protein is mainly expressed in the endoplasmic reticulum (ER) of astrocytes bone cells and certain cancerous cells. CREB3L1 regulates gene expression in response to stress conditions related to the ER making it a focal point of interest in cellular stress response studies.
Biological function summary

CREB3L1 is involved in the regulation of unfolded protein response (UPR). It activates genes responsible for protein folding processing and secretion ensuring proper cellular function. CREB3L1 or OASIS generally does not form complexes but operates predominantly on its own. It serves as a bridge between stress signals received by the ER and the transcriptional machinery of the nucleus thereby playing a critical role in maintaining cellular homeostasis.

Pathways

This transcription factor integrates signals within the unfolded protein response and bone metabolism pathways. CREB3L1 regulates the transcription of genes involved in ER stress response linking it to key proteins such as BiP and CHOP. Additionally CREB3L1 influences osteocalcin transcription tying it to bone formation and matrix production pathways. It directly affects cellular adaptation by controlling gene expression related to ER stress and osteogenesis.

CREB3L1 links closely to osteogenesis imperfecta and certain aspects of glioblastoma. Its regulatory function in osteocalcin expression connects it with bone fragility conditions necessitating in-depth research into CREB3L1-related pathways for potential therapeutic targets. In glioblastoma CREB3L1 expression correlates with tumor cell response to stress making it an essential protein for understanding the ER stress-related mechanisms in cancer progression. Connections with proteins like osteocalcin in bone disorders and BiP in stress responses highlight its importance in disease contexts.

Specifications

Form

Lyophilized

General info

Function

Cyclic AMP-responsive element-binding protein 3-like protein 1. Precursor of the transcription factor form (Processed cyclic AMP-responsive element-binding protein 3-like protein 1), which is embedded in the endoplasmic reticulum membrane with N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic face of the membrane (PubMed : 12054625, PubMed : 16417584, PubMed : 25310401). In response to ER stress or DNA damage, transported to the Golgi, where it is cleaved in a site-specific manner by resident proteases S1P/MBTPS1 and S2P/MBTPS2. The released N-terminal cytosolic domain is translocated to the nucleus where it activates transcription of specific target genes involved in the cell-cycle progression inhibition (PubMed : 12054625, PubMed : 21767813, PubMed : 25310401).. Processed cyclic AMP-responsive element-binding protein 3-like protein 1. Transcription factor involved in cell type specific DNA damage and unfolded protein response (UPR). Binds the DNA consensus sequence 5'-GTGXGCXGC-3' (PubMed : 21767813). Plays a critical role in bone formation through the transcription of COL1A1, and possibly COL1A2, and the secretion of bone matrix proteins. Directly binds to the UPR element (UPRE)-like sequence in an osteoblast-specific COL1A1 promoter region and induces its transcription. Does not regulate COL1A1 in other tissues, such as skin (By similarity). Required to protect astrocytes from ER stress-induced cell death. In astrocytes, binds to the cAMP response element (CRE) of the BiP/HSPA5 promoter and participate in its transcriptional activation (By similarity). In astrocytes and osteoblasts, upon DNA damage, inhibits cell-cycle progression after G2/M phase by binding to promoters and activating transcription of genes encoding cell-cycle inhibitors, such as p21/CDKN1A (By similarity). Required for TGFB1 to activate genes involved in the assembly of collagen extracellular matrix (PubMed : 25310401).. (Microbial infection) May play a role in limiting virus spread by inhibiting proliferation of virus-infected cells. Upon infection with diverse DNA and RNA viruses, inhibits cell-cycle progression by binding to promoters and activating transcription of genes encoding cell-cycle inhibitors, such as p21/CDKN1A (PubMed : 21767813).

Sequence similarities

Belongs to the bZIP family. ATF subfamily.

Post-translational modifications

Upon ER stress or DNA damage, translocated to the Golgi apparatus, where it is processed by regulated intramembrane proteolysis (RIP) to release the cytosol-facing N-terminal transcription factor domain. The cleavage is performed sequentially by site-1 and site-2 proteases (S1P/MBTPS1 and S2P/MBTPS2) (PubMed:16417584, PubMed:21767813, PubMed:25310401, PubMed:27499293). RIP is induced by TGFB1 and ceramide (PubMed:25310401, PubMed:27499293).. N-glycosylated.. Ubiquitinated by HRD1/SYVN1; undergoes 'Lys-48'-linked ubiquitination, followed by rapid proteasomal degradation under normal conditions. Upon ER stress, SYVN1 E3 ubiquitin-protein ligase dissociates from its substrate, ubiquitination does not occur and CREB3L1 is stabilized.

Subcellular localisation

Nucleus

Product protocols

Target data

Cyclic AMP-responsive element-binding protein 3-like protein 1. Precursor of the transcription factor form (Processed cyclic AMP-responsive element-binding protein 3-like protein 1), which is embedded in the endoplasmic reticulum membrane with N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic face of the membrane (PubMed : 12054625, PubMed : 16417584, PubMed : 25310401). In response to ER stress or DNA damage, transported to the Golgi, where it is cleaved in a site-specific manner by resident proteases S1P/MBTPS1 and S2P/MBTPS2. The released N-terminal cytosolic domain is translocated to the nucleus where it activates transcription of specific target genes involved in the cell-cycle progression inhibition (PubMed : 12054625, PubMed : 21767813, PubMed : 25310401).. Processed cyclic AMP-responsive element-binding protein 3-like protein 1. Transcription factor involved in cell type specific DNA damage and unfolded protein response (UPR). Binds the DNA consensus sequence 5'-GTGXGCXGC-3' (PubMed : 21767813). Plays a critical role in bone formation through the transcription of COL1A1, and possibly COL1A2, and the secretion of bone matrix proteins. Directly binds to the UPR element (UPRE)-like sequence in an osteoblast-specific COL1A1 promoter region and induces its transcription. Does not regulate COL1A1 in other tissues, such as skin (By similarity). Required to protect astrocytes from ER stress-induced cell death. In astrocytes, binds to the cAMP response element (CRE) of the BiP/HSPA5 promoter and participate in its transcriptional activation (By similarity). In astrocytes and osteoblasts, upon DNA damage, inhibits cell-cycle progression after G2/M phase by binding to promoters and activating transcription of genes encoding cell-cycle inhibitors, such as p21/CDKN1A (By similarity). Required for TGFB1 to activate genes involved in the assembly of collagen extracellular matrix (PubMed : 25310401).. (Microbial infection) May play a role in limiting virus spread by inhibiting proliferation of virus-infected cells. Upon infection with diverse DNA and RNA viruses, inhibits cell-cycle progression by binding to promoters and activating transcription of genes encoding cell-cycle inhibitors, such as p21/CDKN1A (PubMed : 21767813).
See full target information CREB3L1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com