JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198130

Recombinant human CREBBP protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human CREBBP protein is a Human Fragment protein, in the 1081 to 1197 aa range, expressed in Escherichia coli, with >96%, suitable for SDS-PAGE, FuncS.

View Alternative Names

CBP, CREBBP, CREB-binding protein, Histone lysine acetyltransferase CREBBP, Protein lactyltransferas CREBBP, Protein-lysine acetyltransferase CREBBP

2 Images
Functional Studies - Recombinant human CREBBP protein (AB198130)
  • FuncS

Supplier Data

Functional Studies - Recombinant human CREBBP protein (AB198130)

Activity assay using ab198130.

SDS-PAGE - Recombinant human CREBBP protein (AB198130)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human CREBBP protein (AB198130)

4-20% SDS-PAGE analysis of ab198130 (2μg).

Key facts

Purity

>96% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Assay was performed using a KAT3A / CBP Inhibitor Screening Assay Kit.

Accession

Q92793

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG","proteinLength":"Fragment","predictedMolecularWeight":"41 kDa","actualMolecularWeight":null,"aminoAcidEnd":1197,"aminoAcidStart":1081,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q92793","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CREBBP also known as CREB Binding Protein or CBP is a multifunctional protein with a molecular weight of approximately 265 kDa. This protein serves as a transcriptional coactivator and possesses intrinsic histone acetyltransferase (HAT) activity. CREBBP is ubiquitously expressed making it present in various tissues throughout the body. Its interaction with different transcription factors facilitates transcriptional activation by remodeling chromatin structure.
Biological function summary

CREBBP plays a pivotal role in regulating gene expression by serving as a coactivator that bridges transcription factors with the basal transcription machinery. CREBBP as part of large multiprotein complexes acetylates histones as well as non-histone proteins influencing chromatin accessibility and transcriptional efficiency. Its HAT activity contributes to the regulation of cell cycle differentiation and DNA repair.

Pathways

CREBBP integrates into both the p53 and Hedgehog signaling pathways modulating various cellular responses. In the p53 pathway CREBBP interacts with the tumor suppressor protein p53 enhancing p53’s ability to initiate expression of genes involved in cell cycle arrest and apoptosis. In the Hedgehog pathway CREBBP regulates transcription factors such as Gli proteins. The interplay between CREBBP and these pathways underlines its importance in maintaining cellular homeostasis and preventing oncogenesis.

Mutations or dysregulation of CREBBP are associated with Rubinstein-Taybi syndrome and various cancers including acute myeloid leukemia. In Rubinstein-Taybi syndrome CREBBP mutations impair cognitive development and skeletal malformations. In cancer particularly acute myeloid leukemia alterations in CREBBP disrupt normal cell growth regulation and lead to tumorigenesis. The protein's interaction with factors like p300 another histone acetyltransferase further emphasizes its critical involvement in these pathological conditions.

Specifications

Form

Liquid

General info

Function

Acetylates histones, giving a specific tag for transcriptional activation (PubMed : 21131905, PubMed : 24616510). Mediates acetylation of histone H3 at 'Lys-18' and 'Lys-27' (H3K18ac and H3K27ac, respectively) (PubMed : 21131905). Also acetylates non-histone proteins, like DDX21, FBL, IRF2, MAFG, NCOA3, POLR1E/PAF53 and FOXO1 (PubMed : 10490106, PubMed : 11154691, PubMed : 12738767, PubMed : 12929931, PubMed : 24207024, PubMed : 28790157, PubMed : 30540930, PubMed : 35675826, PubMed : 9707565). Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1. Acts as a circadian transcriptional coactivator which enhances the activity of the circadian transcriptional activators : NPAS2-BMAL1 and CLOCK-BMAL1 heterodimers (PubMed : 14645221). Acetylates PCNA; acetylation promotes removal of chromatin-bound PCNA and its degradation during nucleotide excision repair (NER) (PubMed : 24939902). Acetylates POLR1E/PAF53, leading to decreased association of RNA polymerase I with the rDNA promoter region and coding region (PubMed : 24207024). Acetylates DDX21, thereby inhibiting DDX21 helicase activity (PubMed : 28790157). Acetylates FBL, preventing methylation of 'Gln-105' of histone H2A (H2AQ104me) (PubMed : 30540930). In addition to protein acetyltransferase, can use different acyl-CoA substrates, such as lactoyl-CoA, and is able to mediate protein lactylation (PubMed : 38128537). Catalyzes lactylation of MRE11 in response to DNA damage, thereby promoting DNA double-strand breaks (DSBs) via homologous recombination (HR) (PubMed : 38128537). Functions as a transcriptional coactivator for SMAD4 in the TGF-beta signaling pathway (PubMed : 25514493).

Post-translational modifications

Methylation of the KIX domain by CARM1 blocks association with CREB. This results in the blockade of CREB signaling, and in activation of apoptotic response (By similarity).. Phosphorylated by CHUK/IKKA at Ser-1382 and Ser-1386; these phosphorylations promote cell growth by switching the binding preference of CREBBP from TP53 to NF-kappa-B (PubMed:17434128). Phosphorylated by _ at Ser-124 in response to DNA damage, promoting interaction with MRE11 and lactylation of MRE11 (PubMed:38128537).. Sumoylation negatively regulates transcriptional activity via the recruitment of DAAX.. Autoacetylation is required for binding to protein substrates, such as acetylated histones and acetylated TP53/p53 (PubMed:24616510). Autoacetylation is induced by glucose and fatty acids (PubMed:35675826).

Subcellular localisation

Nucleus

Product protocols

Target data

Acetylates histones, giving a specific tag for transcriptional activation (PubMed : 21131905, PubMed : 24616510). Mediates acetylation of histone H3 at 'Lys-18' and 'Lys-27' (H3K18ac and H3K27ac, respectively) (PubMed : 21131905). Also acetylates non-histone proteins, like DDX21, FBL, IRF2, MAFG, NCOA3, POLR1E/PAF53 and FOXO1 (PubMed : 10490106, PubMed : 11154691, PubMed : 12738767, PubMed : 12929931, PubMed : 24207024, PubMed : 28790157, PubMed : 30540930, PubMed : 35675826, PubMed : 9707565). Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1. Acts as a circadian transcriptional coactivator which enhances the activity of the circadian transcriptional activators : NPAS2-BMAL1 and CLOCK-BMAL1 heterodimers (PubMed : 14645221). Acetylates PCNA; acetylation promotes removal of chromatin-bound PCNA and its degradation during nucleotide excision repair (NER) (PubMed : 24939902). Acetylates POLR1E/PAF53, leading to decreased association of RNA polymerase I with the rDNA promoter region and coding region (PubMed : 24207024). Acetylates DDX21, thereby inhibiting DDX21 helicase activity (PubMed : 28790157). Acetylates FBL, preventing methylation of 'Gln-105' of histone H2A (H2AQ104me) (PubMed : 30540930). In addition to protein acetyltransferase, can use different acyl-CoA substrates, such as lactoyl-CoA, and is able to mediate protein lactylation (PubMed : 38128537). Catalyzes lactylation of MRE11 in response to DNA damage, thereby promoting DNA double-strand breaks (DSBs) via homologous recombination (HR) (PubMed : 38128537). Functions as a transcriptional coactivator for SMAD4 in the TGF-beta signaling pathway (PubMed : 25514493).
See full target information CREBBP

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Nucleic acids research 48:9550-9570 PubMed32810208

2020

Enhancer RNAs predict enhancer-gene regulatory links and are critical for enhancer function in neuronal systems.

Applications

Unspecified application

Species

Unspecified reactive species

Nancy V N Carullo,Robert A Phillips Iii,Rhiana C Simon,Salomon A Roman Soto,Jenna E Hinds,Aaron J Salisbury,Jasmin S Revanna,Kendra D Bunner,Lara Ianov,Faraz A Sultan,Katherine E Savell,Charles A Gersbach,Jeremy J Day
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com