JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB173020

Recombinant Human CTCF protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CTCF protein is a Human Fragment protein, in the 1 to 154 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

Transcriptional repressor CTCF, 11-zinc finger protein, CCCTC-binding factor, CTCFL paralog, CTCF

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, HPLC

applications

Biologically active

No

Accession

P49711

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI","proteinLength":"Fragment","predictedMolecularWeight":"16.93 kDa","actualMolecularWeight":null,"aminoAcidEnd":154,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P49711","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CTCF also known as the CCCTC-binding factor is a highly conserved zinc finger protein involved in transcriptional regulation and chromatin organization. It has a molecular weight of approximately 82 kDa. The CTCF protein plays a critical mechanical role in controlling the three-dimensional architecture of the genome by binding to specific DNA sequences and forming chromatin loops. It is widely expressed in various cell types across tissues where it acts as a transcriptional repressor and activator depending on the context. CTCF immunofluorescence techniques enable the visualization of its dynamic distribution and expression within the nucleus.
Biological function summary

The multipurpose CTCF protein acts in coordinating the spatial organization of the genome. It functions as an insulator by regulating the boundaries between different chromosomal domains and controlling gene expression. CTCF operates within various complexes interacting with cohesin a vital protein complex that facilitates loop formation and influences genome architecture. This interaction helps in maintaining the integrity of the genome structure and proper chromatin insulation which are essential for normal gene function.

Pathways

CTCF plays significant roles in epigenetic regulatory networks and transcriptional pathways. In the epigenetic landscape it influences gene expression through modulation of DNA methylation states at CpG islands interacting with proteins like DNA methyltransferases. In transcriptional pathways CTCF interacts with nuclear factor Y (NF-Y) which contributes to cell cycle regulation by modulating the expression of cell cycle genes. These pathways reflect CTCF's versatility in gene regulation and its influence on maintaining cellular homeostasis.

CTCF disruptions have been implicated in cancer and intellectual disabilities. Mutations or altered expression of CTCF can lead to tumorigenesis as CTCF acts as a tumor suppressor by controlling oncogene and tumor suppressor gene expression. In intellectual disabilities CTCF mutations affect brain development by disrupting the expression of neuronal genes. The protein's interaction with cohesin has links to disorders such as Cornelia de Lange syndrome where cohesin complex dysfunction parallels the phenotypes seen with CTCF aberrations.

Specifications

Form

Liquid

Additional notes

ab173020 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.

General info

Function

Chromatin binding factor that binds to DNA sequence specific sites and regulates the 3D structure of chromatin (PubMed : 16949368, PubMed : 18347100, PubMed : 18654629, PubMed : 19322193). Binds together strands of DNA, thus forming chromatin loops, and anchors DNA to cellular structures, such as the nuclear lamina (PubMed : 18347100, PubMed : 18654629, PubMed : 19322193). Defines the boundaries between active and heterochromatic DNA via binding to chromatin insulators, thereby preventing interaction between promoter and nearby enhancers and silencers (PubMed : 18347100, PubMed : 18654629, PubMed : 19322193). Participates in the allele-specific gene expression at the imprinted IGF2/H19 gene locus (PubMed : 16107875, PubMed : 16815976, PubMed : 17827499). On the maternal allele, binding within the H19 imprinting control region (ICR) mediates maternally inherited higher-order chromatin conformation to restrict enhancer access to IGF2 (By similarity). Mediates interchromosomal association between IGF2/H19 and WSB1/NF1 and may direct distant DNA segments to a common transcription factory (By similarity). Regulates asynchronous replication of IGF2/H19 (By similarity). Plays a critical role in gene silencing over considerable distances in the genome (By similarity). Preferentially interacts with unmethylated DNA, preventing spreading of CpG methylation and maintaining methylation-free zones (PubMed : 18413740). Inversely, binding to target sites is prevented by CpG methylation (PubMed : 18413740). Plays an important role in chromatin remodeling (PubMed : 18413740). Can dimerize when it is bound to different DNA sequences, mediating long-range chromatin looping (PubMed : 12191639). Causes local loss of histone acetylation and gain of histone methylation in the beta-globin locus, without affecting transcription (PubMed : 12191639). When bound to chromatin, it provides an anchor point for nucleosomes positioning (PubMed : 12191639). Seems to be essential for homologous X-chromosome pairing (By similarity). May participate with Tsix in establishing a regulatable epigenetic switch for X chromosome inactivation (PubMed : 11743158). May play a role in preventing the propagation of stable methylation at the escape genes from X-inactivation (PubMed : 11743158). Involved in sister chromatid cohesion (PubMed : 12191639). Associates with both centromeres and chromosomal arms during metaphase and required for cohesin localization to CTCF sites (PubMed : 18550811). Plays a role in the recruitment of CENPE to the pericentromeric/centromeric regions of the chromosome during mitosis (PubMed : 26321640). Acts as a transcriptional repressor binding to promoters of vertebrate MYC gene and BAG1 gene (PubMed : 18413740, PubMed : 8649389, PubMed : 9591631). Also binds to the PLK and PIM1 promoters (PubMed : 12191639). Acts as a transcriptional activator of APP (PubMed : 9407128). Regulates APOA1/C3/A4/A5 gene cluster and controls MHC class II gene expression (PubMed : 18347100, PubMed : 19322193). Plays an essential role in oocyte and preimplantation embryo development by activating or repressing transcription (By similarity). Seems to act as tumor suppressor (PubMed : 12191639).

Sequence similarities

Belongs to the CTCF zinc-finger protein family.

Post-translational modifications

Sumoylated on Lys-74 and Lys-689; sumoylation of CTCF contributes to the repressive function of CTCF on the MYC P2 promoter.

Subcellular localisation

Nucleus

Product protocols

Target data

Chromatin binding factor that binds to DNA sequence specific sites and regulates the 3D structure of chromatin (PubMed : 16949368, PubMed : 18347100, PubMed : 18654629, PubMed : 19322193). Binds together strands of DNA, thus forming chromatin loops, and anchors DNA to cellular structures, such as the nuclear lamina (PubMed : 18347100, PubMed : 18654629, PubMed : 19322193). Defines the boundaries between active and heterochromatic DNA via binding to chromatin insulators, thereby preventing interaction between promoter and nearby enhancers and silencers (PubMed : 18347100, PubMed : 18654629, PubMed : 19322193). Participates in the allele-specific gene expression at the imprinted IGF2/H19 gene locus (PubMed : 16107875, PubMed : 16815976, PubMed : 17827499). On the maternal allele, binding within the H19 imprinting control region (ICR) mediates maternally inherited higher-order chromatin conformation to restrict enhancer access to IGF2 (By similarity). Mediates interchromosomal association between IGF2/H19 and WSB1/NF1 and may direct distant DNA segments to a common transcription factory (By similarity). Regulates asynchronous replication of IGF2/H19 (By similarity). Plays a critical role in gene silencing over considerable distances in the genome (By similarity). Preferentially interacts with unmethylated DNA, preventing spreading of CpG methylation and maintaining methylation-free zones (PubMed : 18413740). Inversely, binding to target sites is prevented by CpG methylation (PubMed : 18413740). Plays an important role in chromatin remodeling (PubMed : 18413740). Can dimerize when it is bound to different DNA sequences, mediating long-range chromatin looping (PubMed : 12191639). Causes local loss of histone acetylation and gain of histone methylation in the beta-globin locus, without affecting transcription (PubMed : 12191639). When bound to chromatin, it provides an anchor point for nucleosomes positioning (PubMed : 12191639). Seems to be essential for homologous X-chromosome pairing (By similarity). May participate with Tsix in establishing a regulatable epigenetic switch for X chromosome inactivation (PubMed : 11743158). May play a role in preventing the propagation of stable methylation at the escape genes from X-inactivation (PubMed : 11743158). Involved in sister chromatid cohesion (PubMed : 12191639). Associates with both centromeres and chromosomal arms during metaphase and required for cohesin localization to CTCF sites (PubMed : 18550811). Plays a role in the recruitment of CENPE to the pericentromeric/centromeric regions of the chromosome during mitosis (PubMed : 26321640). Acts as a transcriptional repressor binding to promoters of vertebrate MYC gene and BAG1 gene (PubMed : 18413740, PubMed : 8649389, PubMed : 9591631). Also binds to the PLK and PIM1 promoters (PubMed : 12191639). Acts as a transcriptional activator of APP (PubMed : 9407128). Regulates APOA1/C3/A4/A5 gene cluster and controls MHC class II gene expression (PubMed : 18347100, PubMed : 19322193). Plays an essential role in oocyte and preimplantation embryo development by activating or repressing transcription (By similarity). Seems to act as tumor suppressor (PubMed : 12191639).
See full target information CTCF

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com