JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271484

Recombinant Human Cullin 3/CUL-3 + RBX1 protein (GST tag N-Terminus, Tag Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Cullin 3/CUL-3 + RBX1 protein (GST tag N-Terminus, Tag Free) is a Human Full Length protein, in the 2 to 768 aa range, expressed in Baculovirus infected Sf9 cells, with >72%, suitable for SDS-PAGE.

View Alternative Names

RNF75, ROC1, RBX1, E3 ubiquitin-protein ligase RBX1, E3 ubiquitin-protein transferase RBX1, Protein ZYP, RING finger protein 75, RING-box protein 1, Regulator of cullins 1, Rbx1, KIAA0617, CUL3, Cullin-3, CUL-3

1 Images
SDS-PAGE - Recombinant Human Cullin 3/CUL-3 + RBX1 protein (GST tag N-Terminus, Tag Free) (AB271484)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Cullin 3/CUL-3 + RBX1 protein (GST tag N-Terminus, Tag Free) (AB271484)

SDS-PAGE analysis of 3.1 μg ab271484.

Key facts

Purity

>72% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P62877

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% Glutathione, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"","proteinLength":"Full Length","predictedMolecularWeight":"117 kDa","actualMolecularWeight":null,"aminoAcidEnd":768,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q13618","tags":[{"tag":"GST","terminus":"N-Terminus"}]},{"sequence":"MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":108,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P62877","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair (PubMed : 10230407, PubMed : 10579999, PubMed : 11961546, PubMed : 15983046, PubMed : 16678110, PubMed : 19112177, PubMed : 19679664, PubMed : 22748924, PubMed : 23455478, PubMed : 27565346, PubMed : 29769719, PubMed : 32355176, PubMed : 33417871, PubMed : 37844242, PubMed : 38326650, PubMed : 39504960, PubMed : 39667934, PubMed : 38316879). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (PubMed : 27565346). The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex mediates ubiquitination of Pol II subunit POLR2A at 'Lys-1268', a critical TC-NER checkpoint (PubMed : 32355176, PubMed : 34526721). Core component of the Cul7-RING(FBXW8) ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 35982156). Core component of a Cul9-RING ubiquitin ligase complex composed of CUL9 and RBX1, which mediates mono-ubiquitination of p53/TP53 (PubMed : 38605244). Recruits the E2 ubiquitin-conjugating enzyme CDC34 to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. As part of a multisubunit complex composed of elongin BC complex (ELOB and ELOC), elongin A/ELOA, RBX1 and CUL5; polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177).

Sequence similarities

Belongs to the RING-box family.

Subcellular localisation

Nucleus

Product protocols

Target data

E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair (PubMed : 10230407, PubMed : 10579999, PubMed : 11961546, PubMed : 15983046, PubMed : 16678110, PubMed : 19112177, PubMed : 19679664, PubMed : 22748924, PubMed : 23455478, PubMed : 27565346, PubMed : 29769719, PubMed : 32355176, PubMed : 33417871, PubMed : 37844242, PubMed : 38326650, PubMed : 39504960, PubMed : 39667934, PubMed : 38316879). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (PubMed : 27565346). The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex mediates ubiquitination of Pol II subunit POLR2A at 'Lys-1268', a critical TC-NER checkpoint (PubMed : 32355176, PubMed : 34526721). Core component of the Cul7-RING(FBXW8) ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 35982156). Core component of a Cul9-RING ubiquitin ligase complex composed of CUL9 and RBX1, which mediates mono-ubiquitination of p53/TP53 (PubMed : 38605244). Recruits the E2 ubiquitin-conjugating enzyme CDC34 to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. As part of a multisubunit complex composed of elongin BC complex (ELOB and ELOC), elongin A/ELOA, RBX1 and CUL5; polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177).
See full target information RBX1

Additional targets

CUL3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com