JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB269216

Recombinant human CX3CL1 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human CX3CL1 protein (Active) is a Human Fragment protein, in the 25 to 100 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

FKN, NTT, SCYD1, A-152E5.2, CX3CL1, Fractalkine, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, Neurotactin, Small-inducible cytokine D1

1 Images
SDS-PAGE - Recombinant human CX3CL1 protein (Active) (AB269216)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human CX3CL1 protein (Active) (AB269216)

SDS-PAGE analysis of ab269216 at 1ug/lane under (-) non-reducing and (+) reducing conditions. 4-20% Tris glycine gel. Stained with coomassie blue.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Human PBMC chemotaxis (first detectable at 10-100 ng/mL).

Accession

P78423

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 0.1 mg/mL in water

Storage buffer

Constituents: 0.1% Trifluoroacetic acid

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG","proteinLength":"Fragment","predictedMolecularWeight":"42 kDa","actualMolecularWeight":null,"aminoAcidEnd":100,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P78423","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C.
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CX3CL1 also known as fractalkine is a chemokine protein characterized mechanically by its dual function as both a chemoattractant and adhesion molecule. It exhibits a unique membrane-bound structure and can exist in a soluble form after proteolytic cleavage. The mass of CX3CL1 is approximately 42-45 kDa. This protein is highly expressed in endothelial cells neurons and tissues with substantial vascularization. Considerable interest surrounds the potential of CX3CL1 assessment in various studies often involving applications like fractalkine ELISA or assays on mouse models.
Biological function summary

CX3CL1 is involved in the immune system and nervous system functions influencing leukocyte adhesion and migration. It is not known to be part of a large multiprotein complex but directly interacts with its fractalkine receptor CX3CR1 on the surface of immune cells. This interaction regulates communication between neurons and microglia which highlights its role in neuroinflammation. CX3CL1's expression and function suggest a significant influence over inflammatory responses and homeostatic balance within these systems.

Pathways

CX3CL1 plays a role in the MAPK and PI3K-Akt pathways vital for cell survival proliferation and migration. Within these pathways CX3CL1 influences and interacts with several proteins thereby modulating inflammatory responses and cellular migration. These pathways are essential for immune system regulation where CX3CL1 acts as a mediator in signal transduction processes that connect immune responses to cellular activities such as proliferation and survival.

CX3CL1 has associations with neurodegenerative disorders like Alzheimer's disease and inflammatory diseases such as rheumatoid arthritis. Alterations in CX3CL1 expression or its fractalkine receptor function can influence disease progression by affecting how immune cells communicate and migrate to inflamed or damaged tissues. CX3CR1 the receptor for CX3CL1 represents an important link in these connections driving research efforts to explore therapies targeting these interactions to alleviate disease symptoms.

Specifications

Form

Lyophilized

Additional notes

nan

General info

Function

Chemokine that acts as a ligand for both CX3CR1 and integrins ITGAV : ITGB3 and ITGA4 : ITGB1 (PubMed : 12055230, PubMed : 21829356, PubMed : 23125415, PubMed : 9782118, PubMed : 9931005). The CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis (PubMed : 12055230, PubMed : 9024663, PubMed : 9177350, PubMed : 9782118). Regulates leukocyte adhesion and migration processes at the endothelium (PubMed : 9024663, PubMed : 9177350). Can activate integrins in both a CX3CR1-dependent and CX3CR1-independent manner (PubMed : 23125415, PubMed : 24789099). In the presence of CX3CR1, activates integrins by binding to the classical ligand-binding site (site 1) in integrins (PubMed : 23125415, PubMed : 24789099). In the absence of CX3CR1, binds to a second site (site 2) in integrins which is distinct from site 1 and enhances the binding of other integrin ligands to site 1 (PubMed : 23125415, PubMed : 24789099).. Processed fractalkine. The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils.. Fractalkine. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells.. (Microbial infection) Mediates the cytoadherence of erythrocytes infected with parasite P.falciparum (strain 3D7) with endothelial cells by interacting with P.falciparum CBP1 and CBP2 expressed at the surface of erythrocytes (PubMed : 27653778). The adhesion prevents the elimination of infected erythrocytes by the spleen (Probable).

Sequence similarities

Belongs to the intercrine delta family.

Post-translational modifications

A soluble short 95 kDa form may be released by proteolytic cleavage from the long membrane-anchored form.. O-glycosylated with core 1 or possibly core 8 glycans.

Product protocols

Target data

Chemokine that acts as a ligand for both CX3CR1 and integrins ITGAV : ITGB3 and ITGA4 : ITGB1 (PubMed : 12055230, PubMed : 21829356, PubMed : 23125415, PubMed : 9782118, PubMed : 9931005). The CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis (PubMed : 12055230, PubMed : 9024663, PubMed : 9177350, PubMed : 9782118). Regulates leukocyte adhesion and migration processes at the endothelium (PubMed : 9024663, PubMed : 9177350). Can activate integrins in both a CX3CR1-dependent and CX3CR1-independent manner (PubMed : 23125415, PubMed : 24789099). In the presence of CX3CR1, activates integrins by binding to the classical ligand-binding site (site 1) in integrins (PubMed : 23125415, PubMed : 24789099). In the absence of CX3CR1, binds to a second site (site 2) in integrins which is distinct from site 1 and enhances the binding of other integrin ligands to site 1 (PubMed : 23125415, PubMed : 24789099).. Processed fractalkine. The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils.. Fractalkine. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells.. (Microbial infection) Mediates the cytoadherence of erythrocytes infected with parasite P.falciparum (strain 3D7) with endothelial cells by interacting with P.falciparum CBP1 and CBP2 expressed at the surface of erythrocytes (PubMed : 27653778). The adhesion prevents the elimination of infected erythrocytes by the spleen (Probable).
See full target information CX3CL1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com