JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112276

Recombinant Human CX3CR1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CX3CR1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 355 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CMKBRL1, GPR13, CX3CR1, CX3C chemokine receptor 1, C-X3-C CKR-1, Beta chemokine receptor-like 1, Fractalkine receptor, G-protein coupled receptor 13, V28, CMK-BRL-1, CMK-BRL1

2 Images
Western blot - Recombinant Human CX3CR1 protein (AB112276)
  • WB

Unknown

Western blot - Recombinant Human CX3CR1 protein (AB112276)

All lanes:

Anti-CX3CR1 antibody (<a href='/en-us/products/unavailable/cx3cr1-antibody-ab8021'>ab8021</a>) at 1 µg/mL

All lanes:

Western blot - Recombinant Human CX3CR1 protein (ab112276) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

true

Exposure time: 4min

SDS-PAGE - Recombinant Human CX3CR1 protein (AB112276)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CX3CR1 protein (AB112276)

12.5% SDS-PAGE analysis of ab112276, stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

P49238

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(recombinant protein). ab112276 can be used as a WB positive control in conjunction with <a href='/en-us/products/unavailable/cx3cr1-antibody-ab8021'>ab8021</a>.</p>" } } }

Sequence info

[{"sequence":"MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL","proteinLength":"Full Length","predictedMolecularWeight":"65.12 kDa","actualMolecularWeight":null,"aminoAcidEnd":355,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P49238","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CX3CR1 also known as fractalkine receptor is a seven-transmembrane G protein-coupled receptor. It has a molecular weight of about 40 kDa. This receptor is expressed in various tissues particularly on immune cells like monocytes natural killer cells T cells and microglia. CX3CR1 binds to its ligand CX3CL1 or fractalkine which is a chemokine involved in directing cell movement. The receptor-ligand interaction is critical for the adhesion and migration of leukocytes to inflammatory sites.
Biological function summary

CX3CR1 plays a significant role in immune regulation and cellular migration. It is not part of a larger protein complex but interacts directly with monocyte and microglia cells influencing their activity. CX3CR1 is recognized as a marker for microglia in flow cytometry applications assisting in the identification of these brain-resident immune cells. The receptor is frequently studied using monoclonal antibodies like anti-CX3CR1 and is subject to inhibition by CX3CR1 antagonists such as 8e10 affecting its function in immune responses.

Pathways

CX3CR1 involves itself heavily in the chemokine signaling pathway and the inflammatory response pathway. Its interaction with CX3CL1 influences the PI3K-Akt signaling pathway modulating cell survival and proliferation. The receptor works in conjunction with CCR2 in monocyte navigation impacting the inflammatory cascade during immune response. Their coordinated action is important for cellular trafficking to sites requiring immune intervention.

CX3CR1 has associations with neurodegenerative diseases such as Alzheimer's disease as well as with atherosclerosis. Changes in its expression and function can exacerbate these conditions. In Alzheimer's disease microglial CX3CR1 may mediate neuroinflammatory processes affecting plaque buildup. In atherosclerosis the receptor is involved in monocyte recruitment to plaques influenced by the related protein fractalkine. Understanding these relationships provides insights into potential therapeutic targets for modulating disease progression.

Specifications

Form

Liquid

General info

Function

Receptor for the C-X3-C chemokine fractalkine (CX3CL1) present on many early leukocyte cells; CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis (PubMed : 12055230, PubMed : 23125415, PubMed : 9390561, PubMed : 9782118). CX3CR1-CX3CL1 signaling mediates cell migratory functions (By similarity). Responsible for the recruitment of natural killer (NK) cells to inflamed tissues (By similarity). Acts as a regulator of inflammation process leading to atherogenesis by mediating macrophage and monocyte recruitment to inflamed atherosclerotic plaques, promoting cell survival (By similarity). Involved in airway inflammation by promoting interleukin 2-producing T helper (Th2) cell survival in inflamed lung (By similarity). Involved in the migration of circulating monocytes to non-inflamed tissues, where they differentiate into macrophages and dendritic cells (By similarity). Acts as a negative regulator of angiogenesis, probably by promoting macrophage chemotaxis (PubMed : 14581400, PubMed : 18971423). Plays a key role in brain microglia by regulating inflammatory response in the central nervous system (CNS) and regulating synapse maturation (By similarity). Required to restrain the microglial inflammatory response in the CNS and the resulting parenchymal damage in response to pathological stimuli (By similarity). Involved in brain development by participating in synaptic pruning, a natural process during which brain microglia eliminates extra synapses during postnatal development (By similarity). Synaptic pruning by microglia is required to promote the maturation of circuit connectivity during brain development (By similarity). Acts as an important regulator of the gut microbiota by controlling immunity to intestinal bacteria and fungi (By similarity). Expressed in lamina propria dendritic cells in the small intestine, which form transepithelial dendrites capable of taking up bacteria in order to provide defense against pathogenic bacteria (By similarity). Required to initiate innate and adaptive immune responses against dissemination of commensal fungi (mycobiota) component of the gut : expressed in mononuclear phagocytes (MNPs) and acts by promoting induction of antifungal IgG antibodies response to confer protection against disseminated C.albicans or C.auris infection (PubMed : 29326275). Also acts as a receptor for C-C motif chemokine CCL26, inducing cell chemotaxis (PubMed : 20974991).. Isoform 1. (Microbial infection) Acts as a coreceptor with CD4 for HIV-1 virus envelope protein.. Isoform 2. (Microbial infection) Acts as a coreceptor with CD4 for HIV-1 virus envelope protein (PubMed : 14607932). May have more potent HIV-1 coreceptothr activity than isoform 1 (PubMed : 14607932).. Isoform 3. (Microbial infection) Acts as a coreceptor with CD4 for HIV-1 virus envelope protein (PubMed : 14607932). May have more potent HIV-1 coreceptor activity than isoform 1 (PubMed : 14607932).

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

This protein is not N-glycosylated which is unusual for G-protein-coupled receptors.

Product protocols

Target data

Receptor for the C-X3-C chemokine fractalkine (CX3CL1) present on many early leukocyte cells; CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis (PubMed : 12055230, PubMed : 23125415, PubMed : 9390561, PubMed : 9782118). CX3CR1-CX3CL1 signaling mediates cell migratory functions (By similarity). Responsible for the recruitment of natural killer (NK) cells to inflamed tissues (By similarity). Acts as a regulator of inflammation process leading to atherogenesis by mediating macrophage and monocyte recruitment to inflamed atherosclerotic plaques, promoting cell survival (By similarity). Involved in airway inflammation by promoting interleukin 2-producing T helper (Th2) cell survival in inflamed lung (By similarity). Involved in the migration of circulating monocytes to non-inflamed tissues, where they differentiate into macrophages and dendritic cells (By similarity). Acts as a negative regulator of angiogenesis, probably by promoting macrophage chemotaxis (PubMed : 14581400, PubMed : 18971423). Plays a key role in brain microglia by regulating inflammatory response in the central nervous system (CNS) and regulating synapse maturation (By similarity). Required to restrain the microglial inflammatory response in the CNS and the resulting parenchymal damage in response to pathological stimuli (By similarity). Involved in brain development by participating in synaptic pruning, a natural process during which brain microglia eliminates extra synapses during postnatal development (By similarity). Synaptic pruning by microglia is required to promote the maturation of circuit connectivity during brain development (By similarity). Acts as an important regulator of the gut microbiota by controlling immunity to intestinal bacteria and fungi (By similarity). Expressed in lamina propria dendritic cells in the small intestine, which form transepithelial dendrites capable of taking up bacteria in order to provide defense against pathogenic bacteria (By similarity). Required to initiate innate and adaptive immune responses against dissemination of commensal fungi (mycobiota) component of the gut : expressed in mononuclear phagocytes (MNPs) and acts by promoting induction of antifungal IgG antibodies response to confer protection against disseminated C.albicans or C.auris infection (PubMed : 29326275). Also acts as a receptor for C-C motif chemokine CCL26, inducing cell chemotaxis (PubMed : 20974991).. Isoform 1. (Microbial infection) Acts as a coreceptor with CD4 for HIV-1 virus envelope protein.. Isoform 2. (Microbial infection) Acts as a coreceptor with CD4 for HIV-1 virus envelope protein (PubMed : 14607932). May have more potent HIV-1 coreceptothr activity than isoform 1 (PubMed : 14607932).. Isoform 3. (Microbial infection) Acts as a coreceptor with CD4 for HIV-1 virus envelope protein (PubMed : 14607932). May have more potent HIV-1 coreceptor activity than isoform 1 (PubMed : 14607932).
See full target information CX3CR1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com