JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB280332

Recombinant human CXCL10/IP10 protein (Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human CXCL10/IP10 protein (Active) is a Human Full Length protein, in the 22 to 98 aa range with >=95% purity, <= 0.005 EU/µg endotoxin level and suitable for SDS-PAGE, Functional studies, mass spectrometry and HPLC. The predicted molecular weight of ab280332 protein is 8.7 kDa.

- Save time and ensure accurate results - use our CXCL10/IP10 protein as a control
- Optimal protein bioactivity, stability and reproducibility
- Available in different sizes to fit your experimental needs

View Alternative Names

INP10, SCYB10, CXCL10, C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, Gamma-IP10, IP-10

4 Images
Mass Spectrometry - Recombinant human CXCL10/IP10 protein (Active) (AB280332)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human CXCL10/IP10 protein (Active) (AB280332)

LC-MS analysis of ab280332.

Predicted MW is 8703.35 Da (+/- 10 Da by ESI-TOF). Observed MW is 8703.52. Additional mass due to truncation as noted.

Functional Studies - Recombinant human CXCL10/IP10 protein (Active) (AB280332)
  • FuncS

Supplier Data

Functional Studies - Recombinant human CXCL10/IP10 protein (Active) (AB280332)

Functional analysis of ab280332.

Fully biologically active determoned by the dose dependent migration of human PBMCs.

ED50 is≤ 3.9ng/ml, corresponding to a specific activity of 2.56 x 105 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3377961-1

SDS-PAGE - Recombinant human CXCL10/IP10 protein (Active) (AB280332)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human CXCL10/IP10 protein (Active) (AB280332)

SDS-PAGE analysis of ab280332.

HPLC - Recombinant human CXCL10/IP10 protein (Active) (AB280332)
  • HPLC

Supplier Data

HPLC - Recombinant human CXCL10/IP10 protein (Active) (AB280332)

HPLC analysis of ab280332.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, SDS-PAGE, FuncS, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active determoned by the dose dependent migration of human PBMCs.

ED50 is≤ 3.9ng/ml, corresponding to a specific activity of 2.56 x 105 units/mg.

Accession

P02778

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our recombinant human CXCL10/IP-10 protein ab280332 as a control.

The ab280332 CXCL10/IP-10 protein is sourced from HEK293 cells and can be used as a positive control in SDS-PAGE, mass spectrometry and HPLC.

Check out our protein gel staining guide for SDS-PAGE here

Premium Bioactive Protein range

The ab280332 CXCL10/IP-10 protein is part of the premium bioactive protein range which are ideal for preclinical cell culture and functional studies. These recombinant proteins are of the highest activity, purity, and consistency, meeting rigorous biophysical characterization.

More premium bioactive proteins can be found here

Sequence info

[{"sequence":"VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP","proteinLength":"Full Length","predictedMolecularWeight":"8.7 kDa","actualMolecularWeight":"8.7 kDa","aminoAcidEnd":98,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P02778","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IP10 also known as CXCL10 is a small cytokine belonging to the CXC chemokine family. It has a molecular mass of approximately 8.7 kDa. IP10 is secreted by several cell types such as monocytes endothelial cells and fibroblasts in response to interferon-gamma (IFN-γ). This protein is involved in immune responses and exhibits various roles especially in chemoattracting cells. Researchers often measure IP10 concentrations using ELISA kits such as the IP-10 ELISA to study its expression levels in different biological contexts.
Biological function summary

IP10 plays a role in modulating the activities of immune cells. It attracts T cells eosinophils monocytes and natural killer (NK) cells by binding to the CXCR3 receptor. IP10 is not part of a larger complex but interacts with other cytokines to influence cell migration and the immune response. High levels of IP10 can reflect strong immune activation which is why it is often measured in inflammatory conditions using standard assays like the IP-10 ELISA kits.

Pathways

The role of IP10 lies within the Th1-type immune response pathway. In this pathway IP10 works alongside other chemokines to recruit and activate immune cells to sites of inflammation or infection. It synergizes with IFN-γ to propagate immune signals. IP10 is also linked with the CXCR3 receptor which plays a critical role in these pathways providing a connection to other proteins such as CXCL9 and CXCL11 which have similar functions in cell-mediated immunity.

IP10 is associated with conditions like multiple sclerosis and rheumatoid arthritis. Elevated IP10 levels often correlate with disease activity in these disorders making it a potential biomarker for disease progression. The protein interacts with other inflammatory mediators such as TNF-α in regulating immune activity within these disease contexts. IP10's involvement in recruiting immune cells contributes to the pathogenic inflammation observed in these conditions.

Specifications

Form

Lyophilized

Additional notes

=95%  by HPLC by HPLC

General info

Function

Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (PubMed : 11157474, PubMed : 22652417, PubMed : 7540647). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization (PubMed : 12750173, PubMed : 19151743). In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (PubMed : 12663757, PubMed : 12750173). Activation of the CXCL10/CXCR3 axis also plays an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity).

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Post-translational modifications

Several proteases can mediate post-secretion cleavages. DPP4 cleaves CXCL10 on its N-terminal 2 amino acids leading to an antagonist form of CXCL10. This dominant negative form is capable of binding CXCR3 but does not induce signaling. MMP9 cleaves 9 amino acids instead.

Product protocols

Target data

Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (PubMed : 11157474, PubMed : 22652417, PubMed : 7540647). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization (PubMed : 12750173, PubMed : 19151743). In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (PubMed : 12663757, PubMed : 12750173). Activation of the CXCL10/CXCR3 axis also plays an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity).
See full target information CXCL10

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

iScience 26:106352 PubMed37009214

2023

Rubella virus infection in endothelial cells reduces angiogenesis via interferon beta-induced CXCL10.

Applications

Unspecified application

Species

Unspecified reactive species

Vivien Henschke,Konstanze Hild,Erik Schilling,Jan Haas,Vanina Filipova,Stephan Erbe,Roman König,Judith M Hübschen,Ulrich Laufs,Claudia Claus,Jes-Niels Boeckel
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com