JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB283898

Recombinant Human CXCL4 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CXCL4 protein (Active) is a Human Full Length protein, in the 32 to 101 aa range, expressed in HEK 293 cells, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, HPLC, Biological Activity.

View Alternative Names

CXCL4, SCYB4, PF4, Platelet factor 4, PF-4, C-X-C motif chemokine 4, Iroplact, Oncostatin-A

2 Images
Biochemical assay - Recombinant Human CXCL4 protein (Active) (AB283898)
  • Biochemical assay

Supplier Data

Biochemical assay - Recombinant Human CXCL4 protein (Active) (AB283898)

Fully biologically active determined by the ability to inhibit FGF-basic dependent proliferation of HUVEC. ED50<= 10.5 ug/ml, corresponding to a specific activity of 95.2 units/mg.

HPLC - Recombinant Human CXCL4 protein (Active) (AB283898)
  • HPLC

Supplier Data

HPLC - Recombinant Human CXCL4 protein (Active) (AB283898)

HPLC analysis of ab283898.

Key facts

Purity

undefined HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Biological Activity, SDS-PAGE, Mass Spec, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the ability to inhibit FGF-basic dependent proliferation of HUVEC. ED50 is ≤ 10.5 ug/ml, corresponding to a specific activity of 95.2 units/mg.

Accession

P02776

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Biological Activity": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES","proteinLength":"Full Length","predictedMolecularWeight":"78.26 kDa","actualMolecularWeight":"78.26 kDa","aminoAcidEnd":101,"aminoAcidStart":32,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P02776","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein Platelet Factor 4 (PF4) also known as CXCL4 is a member of the chemokine (C-X-C motif) ligand family. This small protein has a molecular weight of approximately 7.8 kDa. PF4 is mainly expressed in megakaryocytes and stored in the alpha granules of platelets. During platelet activation PF4 releases into the bloodstream where it interacts with other proteins and cell types. Researchers measure PF4 levels with methods such as PF4 ELISA to study its expression and functions under various physiological and pathological conditions.
Biological function summary

PF4 plays an important role in modulating the immune response and coagulation processes. PF4 is not part of a stable protein complex but can interact dynamically with heparin on the surface of endothelial cells and glycosaminoglycans. It inhibits the action of heparin promoting clot formation and angiogenesis. PF4 also attracts and activates different types of leukocytes and can regulate inflammatory processes influencing how the immune system responds to injury.

Pathways

PF4 significantly interacts with both the coagulation and inflammation pathways. In the coagulation pathway PF4 acts to neutralize heparin-like molecules thereby enhancing thrombosis. It works closely with proteins such as thrombin and fibrinogen contributing to the blood clot cascade. Within the inflammatory pathway PF4's chemokine activity helps direct leukocytes to sites of tissue damage or infection linking it to cytokines and other chemokines that mediate immune responses.

Researchers associate PF4 with conditions such as thrombosis and autoimmune pathologies. In thrombosis the overexpression of PF4 can lead to excessive clot formation pointing to its interaction with proteins like thrombin. PF4 also plays a role in heparin-induced thrombocytopenia (HIT) a disorder where the immune system mistakenly produces antibodies against heparin-PF4 complexes further indicating its direct involvement with immune and coagulation pathways.

Specifications

Form

Lyophilized

Additional notes

SDS PAGE>=95% Purity

General info

Function

Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation (PubMed : 29930254, PubMed : 9531587). Acts via different functional receptors including CCR1, CXCR3A or CXCR3B (PubMed : 18174362, PubMed : 29930254). Upon interaction with CXCR3A receptor, induces activated T-lymphocytes migration mediated via downstream Ras/extracellular signal-regulated kinase (ERK) signaling (PubMed : 18174362, PubMed : 24469069). Neutralizes the anticoagulant effect of heparin by binding more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Plays a role in the inhibition of hematopoiesis and in the maintenance of hematopoietic stem cell (HSC) quiescence (PubMed : 9531587). Chemotactic for neutrophils and monocytes via CCR1 (PubMed : 29930254). Inhibits endothelial cell proliferation. In cooperation with toll-like receptor 8/TLR8, induces chromatin remodeling and activates inflammatory gene expression via the TBK1-IRF5 axis (PubMed : 35701499). In addition, induces myofibroblast differentiation and collagen synthesis in different precursor cells, including endothelial cells, by stimulating endothelial-to-mesenchymal transition (PubMed : 34986347). Interacts with thrombomodulin/THBD to enhance the activation of protein C and thus potentiates its anticoagulant activity (PubMed : 9395524).

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Product protocols

Target data

Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation (PubMed : 29930254, PubMed : 9531587). Acts via different functional receptors including CCR1, CXCR3A or CXCR3B (PubMed : 18174362, PubMed : 29930254). Upon interaction with CXCR3A receptor, induces activated T-lymphocytes migration mediated via downstream Ras/extracellular signal-regulated kinase (ERK) signaling (PubMed : 18174362, PubMed : 24469069). Neutralizes the anticoagulant effect of heparin by binding more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Plays a role in the inhibition of hematopoiesis and in the maintenance of hematopoietic stem cell (HSC) quiescence (PubMed : 9531587). Chemotactic for neutrophils and monocytes via CCR1 (PubMed : 29930254). Inhibits endothelial cell proliferation. In cooperation with toll-like receptor 8/TLR8, induces chromatin remodeling and activates inflammatory gene expression via the TBK1-IRF5 axis (PubMed : 35701499). In addition, induces myofibroblast differentiation and collagen synthesis in different precursor cells, including endothelial cells, by stimulating endothelial-to-mesenchymal transition (PubMed : 34986347). Interacts with thrombomodulin/THBD to enhance the activation of protein C and thus potentiates its anticoagulant activity (PubMed : 9395524).
See full target information PF4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com