JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB109834

Recombinant Human CXCL7/PBP protein

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Human CXCL7/PBP protein is a Human Fragment protein, in the 35 to 128 aa range, expressed in Escherichia coli, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

CTAP3, CXCL7, SCYB7, TGB1, THBGB1, PPBP, Platelet basic protein, PBP, C-X-C motif chemokine 7, Leukocyte-derived growth factor, Macrophage-derived growth factor, Small-inducible cytokine B7, LDGF, MDGF

1 Images
SDS-PAGE - Recombinant Human CXCL7/PBP protein (AB109834)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CXCL7/PBP protein (AB109834)

SDS-PAGE analysis of ab109834 : (1) MW marker, (2) ab109834 at 3μg
Gel concentration : 15%

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P02775

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is released in large amounts from platelets following their activation. It stimulates various processes including mitogenesis, synthesis of extracellular matrix, glucose metabolism and synthesis of plasminogen activator.

Previously labelled as CXCL7.

Sequence info

[{"sequence":"MSSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD","proteinLength":"Fragment","predictedMolecularWeight":"10.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":128,"aminoAcidStart":35,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P02775","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target CXCL7 also known as PBP PBP-172 or PPBP is a chemokine with a molecular mass of around 11 kDa. It is a platelet basic protein (PBP) belonging to the family of CXC chemokines. This protein is extensively expressed in megakaryocytes and stored in the alpha-granules of platelets. Upon platelet activation CXCL7 is released and becomes a potent attractant and activator of neutrophils. It travels through the bloodstream and impacts extracellular signaling processes.
Biological function summary

The chemokine plays a significant role in the regulation of inflammation. CXCL7 is not only an individual entity but can form complexes with glycosaminoglycans on cell surfaces enhancing its functionality. This interaction helps in modulating immune responses by recruiting neutrophils and monocytes to sites of injury or infection. The chemokine contributes to wound healing and tissue repair through its involvement in the inflammatory phase.

Pathways

CXCL7 is involved in the chemokine signaling pathway and is an important mediator in the immune system's response to infections. It is related to other chemokine family proteins like CXCL8 (IL-8) which share similar pathways in inflammatory responses. These proteins interact with specific receptors on leukocytes inducing changes in the cytoskeleton and promoting chemotaxis which is the directed movement towards chemical stimuli.

CXCL7 is associated with various inflammatory conditions and has been implicated in atherosclerosis and rheumatoid arthritis. In these conditions elevated levels of this chemokine correlate with increased recruitment and activation of neutrophils exacerbating inflammation. CXCL7 also shares interactions with other proteins such as CXCL1 affecting the progression and severity of these disorders. The understanding of CXCL7's role in such pathologies offers potential therapeutic avenues for intervention.

Specifications

Form

Liquid

Additional notes

No detergents such as urea, Triton or Tween were used to purify this protein. Purified by using anion exchange chromatography (DEAE sepharose resin) and gel filtration chromatography (Sephacryl S 200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Post-translational modifications

Proteolytic removal of residues 1-9 produces the active peptide connective tissue-activating peptide III (CTAP-III) (low-affinity platelet factor IV (LA-PF4)).. Proteolytic removal of residues 1-13 produces the active peptide beta-thromboglobulin, which is released from platelets along with platelet factor 4 and platelet-derived growth factor.. NAP-2(1-66) is produced by proteolytical processing, probably after secretion by leukocytes other than neutrophils.. NAP-2(73) and NAP-2(74) seem not be produced by proteolytical processing of secreted precursors but are released in an active form from platelets.

Product protocols

Target data

LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
See full target information PPBP

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

The Journal of biological chemistry 266:5785-9 PubMed1826003

1991

Characterization of the human beta-thromboglobulin gene. Comparison with the gene for platelet factor 4.

Applications

Unspecified application

Species

Unspecified reactive species

S Majumdar,D Gonder,B Koutsis,M Poncz

Biochemistry 25:1988-96 PubMed2423119

1986

Characterization of human platelet basic protein, a precursor form of low-affinity platelet factor 4 and beta-thromboglobulin.

Applications

Unspecified application

Species

Unspecified reactive species

J C Holt,M E Harris,A M Holt,E Lange,A Henschen,S Niewiarowski
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com