JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB315076

Recombinant Human CXCL7/PBP Protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CXCL7/PBP Protein is a Human Fragment protein, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for Mass Spec, HPLC.

View Alternative Names

CTAP3, CXCL7, SCYB7, TGB1, THBGB1, PPBP, Platelet basic protein, PBP, C-X-C motif chemokine 7, Leukocyte-derived growth factor, Macrophage-derived growth factor, Small-inducible cytokine B7, LDGF, MDGF

2 Images
Mass Spectrometry - Recombinant Human CXCL7/PBP Protein (AB315076)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant Human CXCL7/PBP Protein (AB315076)

Mass determination by ESI-TOF. Predicted MW is 7690 Da (+/- 10 Da by ESI-TOF). Observed MW is 7685.33.

HPLC - Recombinant Human CXCL7/PBP Protein (AB315076)
  • HPLC

Lab

HPLC - Recombinant Human CXCL7/PBP Protein (AB315076)

HPLC analysis of ab315076

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, HPLC

applications

Biologically active

No

Mass Spectrometry

LC-MS/MS

Accession

P02775

Animal free

Yes

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD","proteinLength":"Fragment","predictedMolecularWeight":"7.69 kDa","actualMolecularWeight":"7.69 kDa","aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P02775","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target CXCL7 also known as PBP PBP-172 or PPBP is a chemokine with a molecular mass of around 11 kDa. It is a platelet basic protein (PBP) belonging to the family of CXC chemokines. This protein is extensively expressed in megakaryocytes and stored in the alpha-granules of platelets. Upon platelet activation CXCL7 is released and becomes a potent attractant and activator of neutrophils. It travels through the bloodstream and impacts extracellular signaling processes.
Biological function summary

The chemokine plays a significant role in the regulation of inflammation. CXCL7 is not only an individual entity but can form complexes with glycosaminoglycans on cell surfaces enhancing its functionality. This interaction helps in modulating immune responses by recruiting neutrophils and monocytes to sites of injury or infection. The chemokine contributes to wound healing and tissue repair through its involvement in the inflammatory phase.

Pathways

CXCL7 is involved in the chemokine signaling pathway and is an important mediator in the immune system's response to infections. It is related to other chemokine family proteins like CXCL8 (IL-8) which share similar pathways in inflammatory responses. These proteins interact with specific receptors on leukocytes inducing changes in the cytoskeleton and promoting chemotaxis which is the directed movement towards chemical stimuli.

CXCL7 is associated with various inflammatory conditions and has been implicated in atherosclerosis and rheumatoid arthritis. In these conditions elevated levels of this chemokine correlate with increased recruitment and activation of neutrophils exacerbating inflammation. CXCL7 also shares interactions with other proteins such as CXCL1 affecting the progression and severity of these disorders. The understanding of CXCL7's role in such pathologies offers potential therapeutic avenues for intervention.

Specifications

Form

Lyophilized

General info

Function

LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Post-translational modifications

Proteolytic removal of residues 1-9 produces the active peptide connective tissue-activating peptide III (CTAP-III) (low-affinity platelet factor IV (LA-PF4)).. Proteolytic removal of residues 1-13 produces the active peptide beta-thromboglobulin, which is released from platelets along with platelet factor 4 and platelet-derived growth factor.. NAP-2(1-66) is produced by proteolytical processing, probably after secretion by leukocytes other than neutrophils.. NAP-2(73) and NAP-2(74) seem not be produced by proteolytical processing of secreted precursors but are released in an active form from platelets.

Product protocols

Target data

LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
See full target information PPBP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com