JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159899

Recombinant Human CXCR4 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CXCR4 protein is a Human Fragment protein, in the 1 to 46 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

CD184, C-X-C chemokine receptor type 4, CXC-R4, CXCR-4, FB22, Fusin, HM89, LCR1, Leukocyte-derived seven transmembrane domain receptor, Lipopolysaccharide-associated protein 3, NPYRL, Stromal cell-derived factor 1 receptor, LESTR, LAP-3, LPS-associated protein 3, SDF-1 receptor, CXCR4

1 Images
SDS-PAGE - Recombinant Human CXCR4 protein (AB159899)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CXCR4 protein (AB159899)

ab159899 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P61073

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":46,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P61073","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CXCR4 also known as C-X-C chemokine receptor type 4 is a G protein-coupled receptor that is involved in signal transduction. It has a molecular weight of approximately 41 kDa. CXCR4 is ubiquitously expressed across various tissues including immune cells like T and B lymphocytes as well as in bone marrow brain and heart. It binds specifically with the ligand CXCL12 also known as stromal cell-derived factor 1 (SDF-1) facilitating responses such as cell migration and proliferation.
Biological function summary

CXCR4 plays an important role in the immune system hematopoiesis and angiogenesis. It does not function alone and is often part of a larger protein complex where it recruits and activates other G proteins. The receptor mediates chemotactic responses directing cells to sites of inflammation or injury. Its interaction with CXCL12 is critical for maintaining immune surveillance aiding in the movement and positioning of immune cells.

Pathways

CXCR4 integrates into significant cellular signaling pathways such as the PI3K/AKT pathway and the MAPK pathway. It collaborates closely with signaling proteins like AKT1 and MAPK1 impacting cell survival and growth. These pathways are essential for various cellular functions including cell cycle progression and apoptosis regulation. The cross-talk between CXCR4 and these pathways underlines its influence on cell fate decisions.

CXCR4 is implicated in cancer metastasis and HIV entry into cells. Overexpression of CXCR4 is observed in several cancers contributing to tumor growth and metastasis. The interaction between CXCR4 and CXCL12 facilitates the infiltration and spread of cancer cells. Additionally in HIV CXCR4 serves as a coreceptor along with CD4 allowing the virus to enter and infect host cells. Both cancer and HIV illustrate CXCR4's central role in disease progression and pathogenesis.

Specifications

Form

Liquid

General info

Function

Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation (PubMed : 10452968, PubMed : 18799424, PubMed : 24912431, PubMed : 28978524). Involved in the AKT signaling cascade (PubMed : 24912431). Plays a role in regulation of cell migration, e.g. during wound healing (PubMed : 28978524). Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels (PubMed : 20228059). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (PubMed : 11276205). Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival (By similarity).. (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus (PubMed : 10074122, PubMed : 10756055, PubMed : 8849450, PubMed : 8929542, PubMed : 9427609).

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

Phosphorylated on agonist stimulation. Rapidly phosphorylated on serine and threonine residues in the C-terminal. Phosphorylation at Ser-324 and Ser-325 leads to recruitment of ITCH, ubiquitination and protein degradation.. Ubiquitinated after ligand binding, leading to its degradation (PubMed:28978524). Ubiquitinated by ITCH at the cell membrane on agonist stimulation (PubMed:14602072, PubMed:34927784). The ubiquitin-dependent mechanism, endosomal sorting complex required for transport (ESCRT), then targets CXCR4 for lysosomal degradation. This process is dependent also on prior Ser-/Thr-phosphorylation in the C-terminal of CXCR4. Also binding of ARRB1 to STAM negatively regulates CXCR4 sorting to lysosomes though modulating ubiquitination of SFR5S.. Sulfation on Tyr-21 is required for efficient binding of CXCL12/SDF-1alpha and promotes its dimerization. Tyr-7 and Tyr-12 are sulfated in a sequential manner after Tyr-21 is almost fully sulfated, with the binding affinity for CXCL12/SDF-1alpha increasing with the number of sulfotyrosines present. Sulfotyrosines Tyr-7 and Tyr-12 occupy clefts on opposing CXCL12 subunits, thus bridging the CXCL12 dimer interface and promoting CXCL12 dimerization.. O- and N-glycosylated. Asn-11 is the principal site of N-glycosylation. There appears to be very little or no glycosylation on Asn-176. N-glycosylation masks coreceptor function in both X4 and R5 laboratory-adapted and primary HIV-1 strains through inhibiting interaction with their Env glycoproteins. The O-glycosylation chondroitin sulfate attachment does not affect interaction with CXCL12/SDF-1alpha nor its coreceptor activity.

Subcellular localisation

Early endosome

Product protocols

Target data

Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation (PubMed : 10452968, PubMed : 18799424, PubMed : 24912431, PubMed : 28978524). Involved in the AKT signaling cascade (PubMed : 24912431). Plays a role in regulation of cell migration, e.g. during wound healing (PubMed : 28978524). Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels (PubMed : 20228059). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (PubMed : 11276205). Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival (By similarity).. (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus (PubMed : 10074122, PubMed : 10756055, PubMed : 8849450, PubMed : 8929542, PubMed : 9427609).
See full target information CXCR4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com