JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB86219

Recombinant human Cyclophilin A protein (Active) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(7 Publications)

Recombinant human Cyclophilin A protein (Active) (His tag N-Terminus) is a Human Full Length protein, in the 1 to 165 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

CYPA, PPIA, Peptidyl-prolyl cis-trans isomerase A, PPIase A, Cyclophilin A, Cyclosporin A-binding protein, Rotamase A

1 Images
SDS-PAGE - Recombinant human Cyclophilin A protein (Active) (His tag N-Terminus) (AB86219)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Cyclophilin A protein (Active) (His tag N-Terminus) (AB86219)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Specific activity is >650 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 nmole of suc-AAPF-pNA per minute at 37°C in Tris-Hcl pH8.0 using chymotrypsin.

Activity Assay
Prepare 180μl assay buffer into a suitable container:
Test is 120μl of 200mM Tris-HCl pH8.0, 50μl of 20nM chymotrypsin and 10μl of 100μg/ml Cyclophilin A protein.
Blank is 130μl of 200mM Tris-HCl pH8.0 and 50μl of 20nM chymotrypsin.
Equilibrate to 37°C and monitor the A405nm until value is constant using a spectrophotometer.
Load 20μl of 5mM Suc-AAPF-pNA into plate. (460mM Lithium chloride, 3mM 2,2,2-Trifluoroethanol in DW. The suc-AAPF-pNA is first dissolved in DMSO and diluted once in 200 mM Tris-HCl (pH8.0). Finally, manufacture the final 5mM with 460mM Lithium chloride, 3mM 2,2,2-Trifluoroethanol).
Add 180μl of assay buffer in 5mM Suc-AAPF-pNA.
Record the absorbance A405nm for 40 minutes at 37 °C.

Accession

P62937

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.242% Tris, 0.116% Sodium chloride, 0.0077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

MW confirme by MALDI-TOF.

Concentration determined by Bradford assay.

Endotoxin levels determined by LAL method.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE","proteinLength":"Full Length","predictedMolecularWeight":"20 kDa","actualMolecularWeight":"20.18 kDa","aminoAcidEnd":165,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P62937","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Liquid

Additional notes

Purified by using conventional chromatography techniques.

General info

Function

Catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (PubMed : 2001362, PubMed : 20676357, PubMed : 21245143, PubMed : 21593166, PubMed : 25678563). Exerts a strong chemotactic effect on leukocytes partly through activation of one of its membrane receptors BSG/CD147, initiating a signaling cascade that culminates in MAPK/ERK activation (PubMed : 11943775, PubMed : 21245143). Activates endothelial cells (ECs) in a pro-inflammatory manner by stimulating activation of NF-kappa-B and ERK, JNK and p38 MAP-kinases and by inducing expression of adhesion molecules including SELE and VCAM1 (PubMed : 15130913). Induces apoptosis in ECs by promoting the FOXO1-dependent expression of CCL2 and BCL2L11 which are involved in EC chemotaxis and apoptosis (PubMed : 31063815). In response to oxidative stress, initiates proapoptotic and antiapoptotic signaling in ECs via activation of NF-kappa-B and AKT1 and up-regulation of antiapoptotic protein BCL2 (PubMed : 23180369). Negatively regulates MAP3K5/ASK1 kinase activity, autophosphorylation and oxidative stress-induced apoptosis mediated by MAP3K5/ASK1 (PubMed : 26095851). Necessary for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and regulates TARDBP binding to RNA UG repeats and TARDBP-dependent expression of HDAC6, ATG7 and VCP which are involved in clearance of protein aggregates (PubMed : 25678563). Plays an important role in platelet activation and aggregation (By similarity). Regulates calcium mobilization and integrin ITGA2B : ITGB3 bidirectional signaling via increased ROS production as well as by facilitating the interaction between integrin and the cell cytoskeleton (By similarity). Binds heparan sulfate glycosaminoglycans (PubMed : 11943775). Inhibits replication of influenza A virus (IAV) (PubMed : 19207730). Inhibits ITCH/AIP4-mediated ubiquitination of matrix protein 1 (M1) of IAV by impairing the interaction of ITCH/AIP4 with M1, followed by the suppression of the nuclear export of M1, and finally reduction of the replication of IAV (PubMed : 22347431, PubMed : 30328013).. (Microbial infection) May act as a mediator between human SARS coronavirus nucleoprotein and BSG/CD147 in the process of invasion of host cells by the virus (PubMed : 15688292).. (Microbial infection) Stimulates RNA-binding ability of HCV NS5A in a peptidyl-prolyl cis-trans isomerase activity-dependent manner.

Sequence similarities

Belongs to the cyclophilin-type PPIase family. PPIase A subfamily.

Post-translational modifications

Acetylation at Lys-125 markedly inhibits catalysis of cis to trans isomerization and stabilizes cis rather than trans forms of the HIV-1 capsid. PPIA acetylation also antagonizes the immunosuppressive effects of cyclosporine by inhibiting the sequential steps of cyclosporine binding and calcineurin inhibition (PubMed:20364129, Ref.12). Acetylation at Lys-125 favors its interaction with TARDBP (PubMed:25678563).

Subcellular localisation

Nucleus

Product protocols

Target data

Catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (PubMed : 2001362, PubMed : 20676357, PubMed : 21245143, PubMed : 21593166, PubMed : 25678563). Exerts a strong chemotactic effect on leukocytes partly through activation of one of its membrane receptors BSG/CD147, initiating a signaling cascade that culminates in MAPK/ERK activation (PubMed : 11943775, PubMed : 21245143). Activates endothelial cells (ECs) in a pro-inflammatory manner by stimulating activation of NF-kappa-B and ERK, JNK and p38 MAP-kinases and by inducing expression of adhesion molecules including SELE and VCAM1 (PubMed : 15130913). Induces apoptosis in ECs by promoting the FOXO1-dependent expression of CCL2 and BCL2L11 which are involved in EC chemotaxis and apoptosis (PubMed : 31063815). In response to oxidative stress, initiates proapoptotic and antiapoptotic signaling in ECs via activation of NF-kappa-B and AKT1 and up-regulation of antiapoptotic protein BCL2 (PubMed : 23180369). Negatively regulates MAP3K5/ASK1 kinase activity, autophosphorylation and oxidative stress-induced apoptosis mediated by MAP3K5/ASK1 (PubMed : 26095851). Necessary for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and regulates TARDBP binding to RNA UG repeats and TARDBP-dependent expression of HDAC6, ATG7 and VCP which are involved in clearance of protein aggregates (PubMed : 25678563). Plays an important role in platelet activation and aggregation (By similarity). Regulates calcium mobilization and integrin ITGA2B : ITGB3 bidirectional signaling via increased ROS production as well as by facilitating the interaction between integrin and the cell cytoskeleton (By similarity). Binds heparan sulfate glycosaminoglycans (PubMed : 11943775). Inhibits replication of influenza A virus (IAV) (PubMed : 19207730). Inhibits ITCH/AIP4-mediated ubiquitination of matrix protein 1 (M1) of IAV by impairing the interaction of ITCH/AIP4 with M1, followed by the suppression of the nuclear export of M1, and finally reduction of the replication of IAV (PubMed : 22347431, PubMed : 30328013).. (Microbial infection) May act as a mediator between human SARS coronavirus nucleoprotein and BSG/CD147 in the process of invasion of host cells by the virus (PubMed : 15688292).. (Microbial infection) Stimulates RNA-binding ability of HCV NS5A in a peptidyl-prolyl cis-trans isomerase activity-dependent manner.
See full target information PPIA

Publications (7)

Recent publications for all applications. Explore the full list and refine your search

JACS Au 1:1147-1157 PubMed34462738

2021

Multiple Roles of SARS-CoV-2 N Protein Facilitated by Proteoform-Specific Interactions with RNA, Host Proteins, and Convalescent Antibodies.

Applications

Unspecified application

Species

Unspecified reactive species

Corinne A Lutomski,Tarick J El-Baba,Jani R Bolla,Carol V Robinson

Frontiers in immunology 12:609196 PubMed33859635

2021

Cyclophilins A, B, and C Role in Human T Lymphocytes Upon Inflammatory Conditions.

Applications

Unspecified application

Species

Unspecified reactive species

Sandra Gegunde,Amparo Alfonso,Rebeca Alvariño,Eva Alonso,Luis M Botana

Molecular and cellular endocrinology 518:110990 PubMed32805334

2020

Extracellular cyclophilin A induces cardiac hypertrophy via the ERK/p47phox pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Mengfei Cao,Ziqi Mao,Meiling Peng,Qianru Zhao,Xia Sun,Jinchuan Yan,Wei Yuan

International journal of molecular sciences 21: PubMed31877775

2019

SP-8356, a Novel Inhibitor of CD147-Cyclophilin A Interactions, Reduces Plaque Progression and Stabilizes Vulnerable Plaques in apoE-Deficient Mice.

Applications

Unspecified application

Species

Unspecified reactive species

Kisoo Pahk,Chanmin Joung,Hwa Young Song,Sungeun Kim,Won-Ki Kim

Oxidative medicine and cellular longevity 2019:2717986 PubMed31182989

2019

Cyclophilin A Protects Cardiomyocytes against Hypoxia/Reoxygenation-Induced Apoptosis via the AKT/Nox2 Pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Fuyu Cheng,Wei Yuan,Mengfei Cao,Rui Chen,Xiuli Wu,Jinchuan Yan

Frontiers in immunology 7:452 PubMed27822214

2016

Secondary Metabolites, Promising Modulators of Immune Response through CD147 Receptor Modulation.

Applications

Unspecified application

Species

Unspecified reactive species

Jon Andoni Sánchez,Amparo Alfonso,Ines Rodriguez,Eva Alonso,José Manuel Cifuentes,Roberto Bermudez,Mostafa E Rateb,Marcel Jaspars,Wael E Houssen,Rainer Ebel,Jioji Tabudravu,Luís M Botana

Protein and peptide letters 22:672-80 PubMed25751267

2015

HIV-Enhancing Factors Are Secreted by Reproductive Epithelia upon Inoculation with Bacterial Vaginosis-Associated Bacteria.

Applications

Unspecified application

Species

Unspecified reactive species

Colleen R Eade,Camila Diaz,Sixue Chen,Amy L Cole,Alexander M Cole
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com