JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158258

Recombinant Human CYP27A1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CYP27A1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 531 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

CYP27, CYP27A1, Cytochrome P-450C27/25, Cytochrome P450 27, Sterol 27-hydroxylase, Vitamin D(3) 25-hydroxylase

1 Images
SDS-PAGE - Recombinant Human CYP27A1 protein (GST tag N-Terminus) (AB158258)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CYP27A1 protein (GST tag N-Terminus) (AB158258)

ab158258 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q02318

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":531,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q02318","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CYP27A1 also known as sterol 27-hydroxylase is a member of the cytochrome P450 superfamily. It functions as a mitochondrial enzyme with a mass of approximately 59 kDa localized in the liver and various other tissues. CYP27A1 hydroxylates its substrates playing an important role in cholesterol metabolism. This process involves the conversion of cholesterol to bile acids an essential step in enabling the excretion of cholesterol from the body. High expression levels of CYP27A1 can be observed in hepatic tissue reflecting its central role in lipid metabolism.
Biological function summary

CYP27A1 participates in cholesterol catabolism. While it does not form large protein complexes it interacts with other enzymes in metabolic pathways. This enzyme initiates the acidic pathway of bile acid synthesis by converting cholesterol into 27-hydroxycholesterol. These transformations are important for maintaining cholesterol homeostasis and for producing bile acids that aid in fat digestion and nutrient absorption.

Pathways

CYP27A1 is central to the bile acid biosynthesis and cholesterol metabolism pathways. It collaborates with other enzymes such as CYP7A1 which is known for initiating the classic pathway of bile acid synthesis. Together they regulate cholesterol levels by metabolizing cholesterol into bile acids. Such pathways are critical in preventing cholesterol accumulation which could lead to various metabolic disorders.

Impairment of CYP27A1 function links to cerebrotendinous xanthomatosis (CTX) marked by the accumulation of cholestanol in tissues leading to neurological dysfunction. Mutations in the CYP27A1 gene disrupt cholesterol metabolism resulting in the accumulation of cholesterol derivatives. Furthermore there is a connection to cardiovascular disease due to the role of CYP27A1 in maintaining cholesterol balance linked with proteins like ApoE impacting lipid transport.

Specifications

Form

Liquid

General info

Function

Cytochrome P450 monooxygenase that catalyzes regio- and stereospecific hydroxylation of cholesterol and its derivatives. Hydroxylates (with R stereochemistry) the terminal methyl group of cholesterol side-chain in a three step reaction to yield at first a C26 alcohol, then a C26 aldehyde and finally a C26 acid (PubMed : 12077124, PubMed : 21411718, PubMed : 28190002, PubMed : 9660774). Regulates cholesterol homeostasis by catalyzing the conversion of excess cholesterol to bile acids via both the 'neutral' (classic) and the 'acid' (alternative) pathways (PubMed : 11412116, PubMed : 1708392, PubMed : 2019602, PubMed : 7915755, PubMed : 9186905, PubMed : 9660774, PubMed : 9790667). May also regulate cholesterol homeostasis via generation of active oxysterols, which act as ligands for NR1H2 and NR1H3 nuclear receptors, modulating the transcription of genes involved in lipid metabolism (PubMed : 12077124, PubMed : 9660774). Plays a role in cholestanol metabolism in the cerebellum. Similarly to cholesterol, hydroxylates cholestanol and may facilitate sterol diffusion through the blood-brain barrier to the systemic circulation for further degradation (PubMed : 28190002). Also hydroxylates retinal 7-ketocholesterol, a noxious oxysterol with pro-inflammatory and pro-apoptotic effects, and may play a role in its elimination from the retinal pigment epithelium (PubMed : 21411718). May play a redundant role in vitamin D biosynthesis. Catalyzes 25-hydroxylation of vitamin D3 that is required for its conversion to a functionally active form (PubMed : 15465040).

Sequence similarities

Belongs to the cytochrome P450 family.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Cytochrome P450 monooxygenase that catalyzes regio- and stereospecific hydroxylation of cholesterol and its derivatives. Hydroxylates (with R stereochemistry) the terminal methyl group of cholesterol side-chain in a three step reaction to yield at first a C26 alcohol, then a C26 aldehyde and finally a C26 acid (PubMed : 12077124, PubMed : 21411718, PubMed : 28190002, PubMed : 9660774). Regulates cholesterol homeostasis by catalyzing the conversion of excess cholesterol to bile acids via both the 'neutral' (classic) and the 'acid' (alternative) pathways (PubMed : 11412116, PubMed : 1708392, PubMed : 2019602, PubMed : 7915755, PubMed : 9186905, PubMed : 9660774, PubMed : 9790667). May also regulate cholesterol homeostasis via generation of active oxysterols, which act as ligands for NR1H2 and NR1H3 nuclear receptors, modulating the transcription of genes involved in lipid metabolism (PubMed : 12077124, PubMed : 9660774). Plays a role in cholestanol metabolism in the cerebellum. Similarly to cholesterol, hydroxylates cholestanol and may facilitate sterol diffusion through the blood-brain barrier to the systemic circulation for further degradation (PubMed : 28190002). Also hydroxylates retinal 7-ketocholesterol, a noxious oxysterol with pro-inflammatory and pro-apoptotic effects, and may play a role in its elimination from the retinal pigment epithelium (PubMed : 21411718). May play a redundant role in vitamin D biosynthesis. Catalyzes 25-hydroxylation of vitamin D3 that is required for its conversion to a functionally active form (PubMed : 15465040).
See full target information CYP27A1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com