JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB275567

Recombinant Human CYP2D6 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CYP2D6 protein (His tag) is a Human Fragment protein, in the 236 to 472 aa range, expressed in Escherichia coli, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CYP2DL1, CYP2D6, Cytochrome P450 2D6, CYPIID6, Cholesterol 25-hydroxylase, Cytochrome P450-DB1, Debrisoquine 4-hydroxylase

1 Images
SDS-PAGE - Recombinant Human CYP2D6 protein (His tag) (AB275567)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CYP2D6 protein (His tag) (AB275567)

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His-T7 tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P10635

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Storage buffer

pH: 8 Constituents: 82.8% Trehalose, 16.38% PBS, 0.17% Sodium-N-Lauroylsarcosinate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"LAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQ","proteinLength":"Fragment","predictedMolecularWeight":"56 kDa","actualMolecularWeight":null,"aminoAcidEnd":472,"aminoAcidStart":236,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P10635","tags":[{"tag":"His-T7","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CYP2D6 also known as cytochrome P450 2D6 is a critical enzyme in the cytochrome P450 superfamily. It possesses a molecular mass of approximately 55 kDa. CYP2D6 is primarily expressed in the liver and to a lesser extent in the brain. As a monooxygenase it catalyzes the oxidation of organic substances including the metabolism of many xenobiotics and drugs. Its activity varies greatly among individuals due to genetic polymorphisms making it an important target for pharmacogenomic studies.
Biological function summary

Enzymes related to drug metabolism perform essential roles in the detoxification of foreign chemicals. CYP2D6 is notably part of the microsomal enzyme complex in the liver. It facilitates the transformation of lipophilic compounds into more water-soluble metabolites rendering them easier for the body to excrete. This enzyme affects the bioavailability and efficacy of many medications such as antidepressants antipsychotics and beta-blockers. Its role is integral in the activation of certain prodrugs converting them into their active pharmacological forms.

Pathways

CYP2D6 functions significantly in drug metabolism and clearance pathways. It takes part in the Phase I metabolism pathway where it initiates the oxidation of drugs setting the stage for further modifications. It interacts closely with other CYP enzymes like CYP3A4 which sometimes share substrates and inhibitors affecting their metabolic activities. CYP2D6's interaction with these pathways emphasizes its involvement in the intricate network of enzyme-mediated drug handling in the body.

Alterations in CYP2D6 activity relate to variations in drug metabolism leading to treatment challenges. For instance poor metabolizers may have increased risks of side effects or therapeutic failures in drugs like codeine which relies on CYP2D6 for activation. Additionally abnormal CYP2D6 activity associates with certain psychiatric disorders where specific drugs require precise metabolic conversion. The interaction between CYP2D6 and other proteins such as CYP3A4 further complicates its role in pharmacotherapy and its impact on individual responses to drugs.

Specifications

Form

Lyophilized

Additional notes

nan

General info

Function

A cytochrome P450 monooxygenase involved in the metabolism of fatty acids, steroids and retinoids (PubMed : 18698000, PubMed : 19965576, PubMed : 20972997, PubMed : 21289075, PubMed : 21576599). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase) (PubMed : 18698000, PubMed : 19965576, PubMed : 20972997, PubMed : 21289075, PubMed : 21576599). Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA) (PubMed : 19965576, PubMed : 20972997). Metabolizes endocannabinoid arachidonoylethanolamide (anandamide) to 20-hydroxyeicosatetraenoic acid ethanolamide (20-HETE-EA) and 8,9-, 11,12-, and 14,15-epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs), potentially modulating endocannabinoid system signaling (PubMed : 18698000, PubMed : 21289075). Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis (PubMed : 21576599). Catalyzes the oxidative transformations of all-trans retinol to all-trans retinal, a precursor for the active form all-trans-retinoic acid (PubMed : 10681376). Also involved in the oxidative metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants.

Sequence similarities

Belongs to the cytochrome P450 family.

Product protocols

Target data

A cytochrome P450 monooxygenase involved in the metabolism of fatty acids, steroids and retinoids (PubMed : 18698000, PubMed : 19965576, PubMed : 20972997, PubMed : 21289075, PubMed : 21576599). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase) (PubMed : 18698000, PubMed : 19965576, PubMed : 20972997, PubMed : 21289075, PubMed : 21576599). Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA) (PubMed : 19965576, PubMed : 20972997). Metabolizes endocannabinoid arachidonoylethanolamide (anandamide) to 20-hydroxyeicosatetraenoic acid ethanolamide (20-HETE-EA) and 8,9-, 11,12-, and 14,15-epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs), potentially modulating endocannabinoid system signaling (PubMed : 18698000, PubMed : 21289075). Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis (PubMed : 21576599). Catalyzes the oxidative transformations of all-trans retinol to all-trans retinal, a precursor for the active form all-trans-retinoic acid (PubMed : 10681376). Also involved in the oxidative metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants.
See full target information CYP2D6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com