JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158177

Recombinant Human Cytochrome C Oxidase subunit VIc/COX6C protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Cytochrome C Oxidase subunit VIc/COX6C protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 75 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Cytochrome c oxidase subunit 6C, Cytochrome c oxidase polypeptide VIc, COX6C

1 Images
SDS-PAGE - Recombinant Human Cytochrome C Oxidase subunit VIc/COX6C protein (GST tag N-Terminus) (AB158177)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Cytochrome C Oxidase subunit VIc/COX6C protein (GST tag N-Terminus) (AB158177)

ab158177 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P09669

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Cytochrome C Oxidase subunit Vic.

Sequence info

[{"sequence":"MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":75,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P09669","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Cytochrome C Oxidase subunit VIc also known as COX6C or cytochrome c oxidase subunit 1 is a component of the enzyme cytochrome c oxidase also referred to as complex IV in the mitochondrial electron transport chain. This subunit contributes significantly to the mechanical activity by aiding the catalytic conversion of molecular oxygen to water. COX6C is relatively lightweight compared to other subunits with an approximate mass of 7.5 kDa. The expression of COX6C predominantly occurs in tissues with high metabolic activity such as the heart muscle and brain where energetic demands are substantial.
Biological function summary

Cytochrome C Oxidase subunit VIc is part of the larger cytochrome c oxidase complex facilitating efficient electron transfer from cytochrome c to oxygen therefore promoting the process of oxidative phosphorylation. This activity is critical for sustaining the mitochondrial membrane potential and ATP production. COX6C's integration within the complex is necessary for its structural integrity and optimal performance. This subunit impacts mitochondrial functionality playing a pivotal role in cellular energy metabolism.

Pathways

Cytochrome C Oxidase subunit VIc contributes to the oxidative phosphorylation pathway and impacts the electron transport chain's efficiency. Its function within this pathway is interconnected with cytochrome c and other cytochrome oxidase complexes. During this process ATP synthase takes advantage of the proton gradient established by the electron flow managed by complex IV. COX6C's role within these pathways ensures effective energy conversion maintaining cellular respiration and energy output in aerobically respiring cells.

Abnormalities in cytochrome C Oxidase subunit VIc expression or function often lead to mitochondrial diseases such as Leigh syndrome and cytochrome c oxidase deficiency. These conditions are linked with defects in cellular respiration causing a wide array of symptoms including neurological and muscular impairments. The subunit's relationship with cytochrome c integral to both electron transfer and apoptosis pathways highlights its influence in these mitochondrial disorders. Understanding COX6C's role offers insights into potential therapeutic targets to mitigate these conditions.

Specifications

Form

Liquid

General info

Function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Sequence similarities

Belongs to the cytochrome c oxidase subunit 6c family.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
See full target information Cytochrome c oxidase subunit 6C

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com