JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB97347

Recombinant Human Cytoglobin protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Cytoglobin protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 190 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

STAP, CYGB, Cytoglobin, Histoglobin, Nitric oxygen dioxygenase CYGB, Nitrite reductase CYGB, Pseudoperoxidase CYGB, Stellate cell activation-associated protein, Superoxide dismutase CYGB, HGb, NOD

1 Images
SDS-PAGE - Recombinant Human Cytoglobin protein (AB97347)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Cytoglobin protein (AB97347)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q8WWM9

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP","proteinLength":"Full Length","predictedMolecularWeight":"23.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":190,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q8WWM9","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Cytoglobin also known as CYGB is a globin protein with a molecular weight of approximately 21 kDa. This protein is part of the vertebrate globin family and exhibits oxygen-binding properties. Cytoglobin is mainly expressed in fibroblasts and is detectable in various tissues including the liver brain and kidney. It functions as an intracellular hemoprotein which allows it to facilitate oxygen transport and storage similar to other globins like hemoglobin and myoglobin.
Biological function summary

This globin plays a role in cellular protective mechanisms. Cytoglobin participates in protecting cells from hypoxic and oxidative stress thereby contributing to oxygen homeostasis. Although it is not part of a known protein complex its ability to bind oxygen and reactive oxygen species indicates its significant role in mitigating cellular damage. By maintaining a balance of oxygen levels inside cells cytoglobin helps preserve cellular integrity under stressful conditions.

Pathways

Cytoglobin interacts in significant biological processes related to oxygen regulation. It is closely involved in the hypoxia response pathway where it aids in adapting cells to low oxygen environments. Cytoglobin operates alongside proteins such as hypoxia-inducible factors (HIFs) which help regulate gene expression in response to oxygen availability. It also plays a role in the oxidative stress response connecting to systems involving antioxidant proteins that help mitigate the effects of reactive oxygen species.

Cytoglobin has links to conditions like cancer and fibrotic diseases. Its role in oxygen regulation and response to hypoxia makes it relevant in tumor biology as tumors often create hypoxic environments that promote cancer progression. Cytoglobin's connection to cancer involves interactions with hypoxia-inducible factors that drive tumor adaptability. Additionally in fibrotic diseases such as liver fibrosis cytoglobin's expression levels correlate with disease severity suggesting it as a marker in fibrosis progression. This relation implies potential interactions with proteins like transforming growth factor-beta (TGF-β) which plays a role in fibrotic tissue development.

Specifications

Form

Liquid

Additional notes

ab97347 is purified using conventional chromatography techniques.

General info

Function

Probable multifunctional globin with a hexacoordinated heme iron required for the catalysis of various reactions depending on redox condition of the cell as well as oxygen availability (PubMed : 11893755, PubMed : 12359339, PubMed : 15165856, PubMed : 19147491, PubMed : 20511233, PubMed : 28393874, PubMed : 28671819, PubMed : 29128400, PubMed : 33576020, PubMed : 34930834). Has a nitric oxide dioxygenase (NOD) activity and is most probably involved in cell-mediated and oxygen-dependent nitric oxide consumption (PubMed : 19147491, PubMed : 20511233, PubMed : 28393874, PubMed : 28671819). By scavenging this second messenger may regulate several biological processes including endothelium-mediated vasodilation and vascular tone (PubMed : 19147491, PubMed : 28393874). Under normoxic conditions functions as a nitric oxide dioxygenase (NOD) but under hypoxic conditions the globin may switch its function to that of a nitrite (NO2) reductase (NiR), generating nitric oxide (PubMed : 29128400). Could also have peroxidase and superoxide dismutase activities, detoxifying reactive oxygen species and protecting cells against oxidative stress (PubMed : 12359339, PubMed : 33576020, PubMed : 34930834). Also binds dioxygen with low affinity and could function as an oxygen sensor but has probably no function as a respiratory oxygen carrier (PubMed : 11893755, PubMed : 15299006, PubMed : 20553503).

Sequence similarities

Belongs to the globin family.

Post-translational modifications

The formation of an intramolecular disulfide bond between cysteines Cys-38 and Cys-83 specifically enhances the nitrite reductase activity.

Product protocols

Target data

Probable multifunctional globin with a hexacoordinated heme iron required for the catalysis of various reactions depending on redox condition of the cell as well as oxygen availability (PubMed : 11893755, PubMed : 12359339, PubMed : 15165856, PubMed : 19147491, PubMed : 20511233, PubMed : 28393874, PubMed : 28671819, PubMed : 29128400, PubMed : 33576020, PubMed : 34930834). Has a nitric oxide dioxygenase (NOD) activity and is most probably involved in cell-mediated and oxygen-dependent nitric oxide consumption (PubMed : 19147491, PubMed : 20511233, PubMed : 28393874, PubMed : 28671819). By scavenging this second messenger may regulate several biological processes including endothelium-mediated vasodilation and vascular tone (PubMed : 19147491, PubMed : 28393874). Under normoxic conditions functions as a nitric oxide dioxygenase (NOD) but under hypoxic conditions the globin may switch its function to that of a nitrite (NO2) reductase (NiR), generating nitric oxide (PubMed : 29128400). Could also have peroxidase and superoxide dismutase activities, detoxifying reactive oxygen species and protecting cells against oxidative stress (PubMed : 12359339, PubMed : 33576020, PubMed : 34930834). Also binds dioxygen with low affinity and could function as an oxygen sensor but has probably no function as a respiratory oxygen carrier (PubMed : 11893755, PubMed : 15299006, PubMed : 20553503).
See full target information CYGB

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com