JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB131780

Recombinant Human DC-SIGN protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DC-SIGN protein is a Human Full Length protein, in the 1 to 404 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CD209, CLEC4L, CD209 antigen, C-type lectin domain family 4 member L, Dendritic cell-specific ICAM-3-grabbing non-integrin 1, DC-SIGN, DC-SIGN1

1 Images
SDS-PAGE - Recombinant Human DC-SIGN protein (AB131780)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human DC-SIGN protein (AB131780)

12.5% SDS-PAGE analysis of ab131780 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

Q9NNX6

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA","proteinLength":"Full Length","predictedMolecularWeight":"72.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":404,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9NNX6","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response.. On DCs it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates. May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2. Seems to regulate DC-induced T-cell proliferation by binding to ICAM3 on T-cells in the immunological synapse formed between DC and T-cells.. (Microbial infection) Acts as an attachment receptor for HIV-1 and HIV-2.. (Microbial infection) Acts as an attachment receptor for Ebolavirus.. (Microbial infection) Acts as an attachment receptor for Cytomegalovirus.. (Microbial infection) Acts as an attachment receptor for HCV.. (Microbial infection) Acts as an attachment receptor for Dengue virus.. (Microbial infection) Acts as an attachment receptor for Measles virus.. (Microbial infection) Acts as an attachment receptor for Herpes simplex virus 1.. (Microbial infection) Acts as an attachment receptor for Influenzavirus A.. (Microbial infection) Acts as an attachment receptor for SARS-CoV.. (Microbial infection) Acts as an attachment receptor for Japanese encephalitis virus.. (Microbial infection) Acts as an attachment receptor for Lassa virus (PubMed : 23966408). Acts as an attachment receptor for Marburg virusn.. (Microbial infection) Acts as an attachment receptor for Respiratory syncytial virus.. (Microbial infection) Acts as an attachment receptor for Rift valley fever virus and uukuniemi virus.. (Microbial infection) Acts as an attachment receptor for West-nile virus.. (Microbial infection) Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of bacterial pathogen antigens, including Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA (PubMed : 16379498). Recognition of M.tuberculosis by dendritic cells occurs partially via this molecule (PubMed : 16092920, PubMed : 21203928).

Product protocols

Target data

Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response.. On DCs it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates. May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2. Seems to regulate DC-induced T-cell proliferation by binding to ICAM3 on T-cells in the immunological synapse formed between DC and T-cells.. (Microbial infection) Acts as an attachment receptor for HIV-1 and HIV-2.. (Microbial infection) Acts as an attachment receptor for Ebolavirus.. (Microbial infection) Acts as an attachment receptor for Cytomegalovirus.. (Microbial infection) Acts as an attachment receptor for HCV.. (Microbial infection) Acts as an attachment receptor for Dengue virus.. (Microbial infection) Acts as an attachment receptor for Measles virus.. (Microbial infection) Acts as an attachment receptor for Herpes simplex virus 1.. (Microbial infection) Acts as an attachment receptor for Influenzavirus A.. (Microbial infection) Acts as an attachment receptor for SARS-CoV.. (Microbial infection) Acts as an attachment receptor for Japanese encephalitis virus.. (Microbial infection) Acts as an attachment receptor for Lassa virus (PubMed : 23966408). Acts as an attachment receptor for Marburg virusn.. (Microbial infection) Acts as an attachment receptor for Respiratory syncytial virus.. (Microbial infection) Acts as an attachment receptor for Rift valley fever virus and uukuniemi virus.. (Microbial infection) Acts as an attachment receptor for West-nile virus.. (Microbial infection) Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of bacterial pathogen antigens, including Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA (PubMed : 16379498). Recognition of M.tuberculosis by dendritic cells occurs partially via this molecule (PubMed : 16092920, PubMed : 21203928).
See full target information CD209

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com