JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB163967

Recombinant Human DDX54 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DDX54 protein (GST tag N-Terminus) is a Human Fragment protein, in the 778 to 881 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

ATP-dependent RNA helicase DDX54, ATP-dependent RNA helicase DP97, DEAD box RNA helicase 97 kDa, DEAD box protein 54, DDX54

1 Images
SDS-PAGE - Recombinant Human DDX54 protein (GST tag N-Terminus) (AB163967)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human DDX54 protein (GST tag N-Terminus) (AB163967)

ab163967 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q8TDD1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":881,"aminoAcidStart":778,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q8TDD1","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

DDX54 also known as DEAD Box Polypeptide 54 or DP97 is an ATP-dependent RNA helicase that belongs to the DEAD box family. It plays a mechanical role in the unwinding and remodeling of RNA secondary structures facilitating various RNA metabolic processes. This protein has a molecular mass of approximately 82 kDa and expresses widely in various tissues including the liver and brain. Its function is critical for maintaining normal cellular physiology by participating in processes like transcription regulation and ribosome biogenesis.
Biological function summary

DDX54 interacts with nuclear hormone receptors such as the Estrogen receptor to modulate gene expression. It acts as a coregulator in this context affecting transcriptional regulation and cellular response to hormones. This protein forms part of a multiprotein complex that functions in transcriptional machinery highlighting its integration into larger structural and functional frameworks within the cell. Through these interactions DDX54 significantly impacts cellular growth differentiation and response to external stimuli.

Pathways

DDX54 plays an important role in the steroid hormone receptor signaling pathway and the ribosome biogenesis pathway. It interacts with proteins including the Estrogen receptor and other coregulators influencing the expression of genes involved in cell proliferation and metabolism. These interactions position DDX54 as a critical node in cellular communication affecting pathways that manage cellular growth and maintenance.

DDX54 has associations with breast cancer and neurodegenerative diseases. In breast cancer it interacts with the Estrogen receptor influencing estrogen-responsive genes that can drive tumor progression. Its role in neurodegenerative diseases involves regulating stress response pathways where misregulated RNA processing might contribute to disease pathology. Connections to other proteins implicated in these diseases highlight its potential as a therapeutic target for intervention.

Specifications

Form

Liquid

General info

Function

Nucleolar RNA helicase that is involved in diverse cellular processes including ribosome biogenesis, DNA damage response, RNA splicing, transcriptional regulation, innate immunity, and nervous system development. Plays an essential role in the formation of the ribosome active site by remodeling rRNA structure and initiating peptidyl transferase center formation (PubMed : 38632236). Represses the transcriptional activity of several nuclear receptors. Regulates transcriptome dynamics during DNA damage response. Mechanistically, acts via increased interaction with a well-defined class of pre-mRNAs that contain introns with weak acceptor splice sites, as well as by protein-protein contacts within components of U2 snRNP and spliceosomal B complex. These activities lead to reduced intron retention and enhanced processing rates of its target transcripts (PubMed : 28596291). Acts as an inhibitor of type I interferon antiviral response by facilitating ALKBH5-mediated demethylation of specific transcripts (PubMed : 40793791). Contributes to central nervous system myelination, likely through regulation of oligodendrocyte differentiation and myelin sheath formation (By similarity).

Sequence similarities

Belongs to the DEAD box helicase family. DDX54/DBP10 subfamily.

Subcellular localisation

Nucleus

Product protocols

Target data

Nucleolar RNA helicase that is involved in diverse cellular processes including ribosome biogenesis, DNA damage response, RNA splicing, transcriptional regulation, innate immunity, and nervous system development. Plays an essential role in the formation of the ribosome active site by remodeling rRNA structure and initiating peptidyl transferase center formation (PubMed : 38632236). Represses the transcriptional activity of several nuclear receptors. Regulates transcriptome dynamics during DNA damage response. Mechanistically, acts via increased interaction with a well-defined class of pre-mRNAs that contain introns with weak acceptor splice sites, as well as by protein-protein contacts within components of U2 snRNP and spliceosomal B complex. These activities lead to reduced intron retention and enhanced processing rates of its target transcripts (PubMed : 28596291). Acts as an inhibitor of type I interferon antiviral response by facilitating ALKBH5-mediated demethylation of specific transcripts (PubMed : 40793791). Contributes to central nervous system myelination, likely through regulation of oligodendrocyte differentiation and myelin sheath formation (By similarity).
See full target information DDX54

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com