JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB116983

Recombinant Human DEFA6 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DEFA6 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 100 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

DEF6, DEFA6, Defensin-6

1 Images
SDS-PAGE - Recombinant Human DEFA6 protein (GST tag N-Terminus) (AB116983)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human DEFA6 protein (GST tag N-Terminus) (AB116983)

12.5% SDS-PAGE showing ab116983 at approximately 37.07kDa.
Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Q01524

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Recombinant protein.</p>" } } }

Sequence info

[{"sequence":"MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL","proteinLength":"Full Length","predictedMolecularWeight":"37.07 kDa","actualMolecularWeight":null,"aminoAcidEnd":100,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q01524","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

DEFA6 also known as human defensin alpha 6 carries out essential mechanical functions as part of the innate immune system. It has a mass of around 9.4 kDa and is expressed mainly in the Paneth cells of the small intestine. This protein belongs to a family known for its antimicrobial properties and it plays a significant role in providing defense against pathogens in the gastrointestinal tract.
Biological function summary

DEFA6 acts as an important antimicrobial peptide that disrupts the integrity of microbial cell membranes leading to lysis and cell death. It does not operate as part of a complex but functions independently. The protein contributes significantly to the maintenance of intestinal homeostasis and helps protect the mucosal surface from infection through direct antimicrobial activity.

Pathways

DEFA6 engages in host defense and immune response pathways. It interacts with other proteins such as lysozyme and secretory phospholipase A2 to enhance antimicrobial effectiveness. These interactions indicate DEFA6's contribution in creating a hostile environment for pathogens which is important in pathways related to immune response.

DEFA6 has implications in conditions such as Crohn's disease and ulcerative colitis. Reduced expression of DEFA6 has been observed in these disorders suggesting a role in their pathogenesis. The protein relates to calprotectin in the context of these diseases as both are markers for inflammation and dysregulation in the gut. Investigating DEFA6 further can offer insights into treatment strategies for inflammatory bowel diseases.

Specifications

Form

Liquid

General info

Function

Host-defense peptide that contributes to intestinal innate immunity and mediates homeostasis at mucosal surfaces by forming higher-order oligomers that capture bacteria and prevent microbial invasion of the epithelium (PubMed : 15616305, PubMed : 17088326, PubMed : 25158166, PubMed : 25354318, PubMed : 28026958). After binding to bacterial surface proteins, undergoes ordered self-assembly to form fibril-like nanonets that surround and entangle bacteria and thereby prevent bacterial invasion across the epithelial barrier (PubMed : 22722251). Entangles and agglutinates Gram-negative bacteria, such as E.coli, S.typhimurium and Y.enterocolitica, and Gram-positive bacteria such as L.monocytogenes, thereby protecting the intestine against invasion by enteric bacterial pathogens (PubMed : 22722251, PubMed : 25158166, PubMed : 27076903). Blocks adhesion of C.albicans to intestinal epithelial cells and thereby suppresses fungal invasion of epithelial cells and biofilm formation (PubMed : 28026958). Under reducing conditions and in an acidic environment similar to the intestinal milieu, exhibits inhibitory activity against anaerobic bacteria such as B.adolescentis, L.acidophilus and B.breve, as well as B.longum and S.thermophilus, possibly by leading to alterations in bacterial cell envelope structures (PubMed : 25354318). The disulfide-linked oxidized form exhibits negligible antimicrobial activity against Gram-negative and Gram-positive bacteria, as compared to the enteric defensin DEFA5 (PubMed : 15616305, PubMed : 17088326).

Sequence similarities

Belongs to the alpha-defensin family.

Post-translational modifications

Proteolytically cleaved by trypsin at Arg-68; the propeptide is stored in the tissue of the small intestine and the mature peptide is found in the luminal fluid; cleavage may occur during or after release into the lumen (PubMed:27076903). The N-terminal propeptide region suppresses self-assembly and renders DEFA6 propeptide unable to agglutinate bacteria and protect human epithelial cells from bacterial invasion (PubMed:27076903).. Under reducing conditions, naturally present in the gut owing to the low redox potential or enzymatically generated by the thioredoxin system, the disulfide bridges are opened leading to a conformational change of DEF6, thereby changing its antimicrobial spectrum (PubMed:25354318). The reduced form exhibits inhibitory activity against anaerobic bacteria, in contrast to the minimal antimicrobial activity of the disulfide-linked oxidized form (PubMed:15616305, PubMed:17088326, PubMed:25354318). The formation of higher-order nanonets and bacterial entrapment is independent of the redox state (PubMed:30808760).

Product protocols

Target data

Host-defense peptide that contributes to intestinal innate immunity and mediates homeostasis at mucosal surfaces by forming higher-order oligomers that capture bacteria and prevent microbial invasion of the epithelium (PubMed : 15616305, PubMed : 17088326, PubMed : 25158166, PubMed : 25354318, PubMed : 28026958). After binding to bacterial surface proteins, undergoes ordered self-assembly to form fibril-like nanonets that surround and entangle bacteria and thereby prevent bacterial invasion across the epithelial barrier (PubMed : 22722251). Entangles and agglutinates Gram-negative bacteria, such as E.coli, S.typhimurium and Y.enterocolitica, and Gram-positive bacteria such as L.monocytogenes, thereby protecting the intestine against invasion by enteric bacterial pathogens (PubMed : 22722251, PubMed : 25158166, PubMed : 27076903). Blocks adhesion of C.albicans to intestinal epithelial cells and thereby suppresses fungal invasion of epithelial cells and biofilm formation (PubMed : 28026958). Under reducing conditions and in an acidic environment similar to the intestinal milieu, exhibits inhibitory activity against anaerobic bacteria such as B.adolescentis, L.acidophilus and B.breve, as well as B.longum and S.thermophilus, possibly by leading to alterations in bacterial cell envelope structures (PubMed : 25354318). The disulfide-linked oxidized form exhibits negligible antimicrobial activity against Gram-negative and Gram-positive bacteria, as compared to the enteric defensin DEFA5 (PubMed : 15616305, PubMed : 17088326).
See full target information DEFA6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com