JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB174392

Recombinant Human DEFB118 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DEFB118 protein (His tag N-Terminus) is a Human Full Length protein, in the 21 to 123 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C20orf63, DEFB18, ESC42, DEFB118, Defensin beta 118, Beta-defensin 18, Epididymal secretory protein 13.6, DEFB-18, ESP13.6

1 Images
SDS-PAGE - Recombinant Human DEFB118 protein (His tag N-Terminus) (AB174392)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human DEFB118 protein (His tag N-Terminus) (AB174392)

15% SDS-PAGE analysis of 3 μg ab174392.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q96PH6

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris-HCl buffer, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS","proteinLength":"Full Length","predictedMolecularWeight":"13.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":123,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q96PH6","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

DEFB118 also known as Beta-defensin 118 is a protein involved in the immune response. This defensin family member possesses antimicrobial properties that contribute to the innate immune defense by disrupting the cell membrane of invading pathogens. DEFB118 has a molecular mass of approximately 19 kDa. It is expressed in the epithelial tissues specifically in the male reproductive tract indicating its role in protecting these tissues from infections.
Biological function summary

DEFB118 plays a role in enhancing the innate immune system by acting as an antimicrobial peptide. It participates in the disruption of microbial cell membranes leading to the death of invading microorganisms. DEFB118 does not operate in isolation but can interact with other elements of the immune system to boost mucosal defenses. It doesn’t form part of larger protein complexes but engages with the immune cells and modulates their activity towards pathogens.

Pathways

DEFB118 is involved in the defense pathways that maintain mucosal immunity. Its mechanism of action links it closely with the pathways responsible for pathogen recognition and elimination. DEFB118 interacts with related proteins such as other defensins and components of the Toll-like receptor pathway which are essential in recognizing pathogen-associated molecular patterns. These interactions ensure a rapid response to microbial threats.

DEFB118 has implications in reproductive and autoimmune conditions. Its antimicrobial activity is significant in preventing infections in the male reproductive tract potentially linking it to conditions like epididymitis if dysfunctional. Furthermore there’s a connection between DEFB118 and systemic autoimmune disorders where dysregulation of antimicrobial peptides can contribute to abnormal immune responses. Proteins like alpha-defensins also display similar functional roles and associations with these diseases.

Specifications

Form

Liquid

Additional notes

ab174392 is purified using conventional chromatography techniques.

General info

Function

Host defense peptide that exhibits antimicrobial activity against both Gram-negative bacteria, such as E.coli and S.typhimurium, and Gram-positive bacteria, such as S.aureus and B.subtilis (PubMed : 15033915, PubMed : 33224970). Inhibits cell adhesion of E.coli on intestinal epithelial enterocytes (PubMed : 33224970). Causes rapid permeabilization of both the outer and inner membrane of E.coli, leading to morphological alterations on the bacterial surface (PubMed : 15033915). Binds to bacterial lipopolysaccharides (LPS) with high affinity, and may thereby be involved in immunoregulation through LPS neutralization (PubMed : 33181266). May contribute to epididymal innate immunity and protect the sperm against attack by microorganisms (PubMed : 15033915).

Sequence similarities

Belongs to the beta-defensin family.

Post-translational modifications

The three-dimensional structure formed by the three intramolecular disulfide bridges is indispensable for antimicrobial activity.

Product protocols

Target data

Host defense peptide that exhibits antimicrobial activity against both Gram-negative bacteria, such as E.coli and S.typhimurium, and Gram-positive bacteria, such as S.aureus and B.subtilis (PubMed : 15033915, PubMed : 33224970). Inhibits cell adhesion of E.coli on intestinal epithelial enterocytes (PubMed : 33224970). Causes rapid permeabilization of both the outer and inner membrane of E.coli, leading to morphological alterations on the bacterial surface (PubMed : 15033915). Binds to bacterial lipopolysaccharides (LPS) with high affinity, and may thereby be involved in immunoregulation through LPS neutralization (PubMed : 33181266). May contribute to epididymal innate immunity and protect the sperm against attack by microorganisms (PubMed : 15033915).
See full target information DEFB118

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com