JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB111640

Recombinant Human Density Regulated Protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Density Regulated Protein is a Human Full Length protein, in the 1 to 198 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

DRP1, H14, DENR, Density-regulated protein, DRP, Protein DRP1, Smooth muscle cell-associated protein 3, SMAP-3

1 Images
SDS-PAGE - Recombinant Human Density Regulated Protein (AB111640)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Density Regulated Protein (AB111640)

SDS-PAGE of ab111640 (3µg) under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

O43583

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.04% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK","proteinLength":"Full Length","predictedMolecularWeight":"24.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":198,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O43583","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Density Regulated Protein also known as NDRG1 is integral to various cellular processes. It weighs approximately 43 kDa and is encoded by the NDRG1 gene. This protein is widely expressed in many tissues including the liver brain heart and skeletal muscle. NDRG1 shows a specific functional expression in cells undergoing differentiation and stress responses. Researchers have identified its connection with the regulation of cell growth and proliferation leading to its descriptive name.
Biological function summary

Density Regulated Protein plays an important role in cellular stress responses and differentiation regulation. This protein interacts with various signaling molecules indicating its participation in larger protein complexes. It modulates the cell cycle and is involved in response to hypoxia. It also plays a critical role in inhibiting metastasis showing its importance in maintaining normal cell behavior and suppressing abnormal growth.

Pathways

NDRG1 integrates prominently within the PI3K/AKT signaling pathway. This pathway is essential for regulation of cell survival metabolism and growth. Within this context the protein interacts with and influences other proteins such as PTEN and mTOR which are key components of the pathway. Moreover it cross-talks with other pathways such as TGF-beta further highlighting its multifaceted roles in cellular dynamics.

Density Regulated Protein is linked to several conditions notably cancer and neurodegenerative diseases. In cancer its expression levels are often altered correlating with tumor suppression and metastasis inhibition. The interaction with p53 a well-known tumor suppressor protein illustrates the significance of NDRG1 in oncology research. Additionally malfunctions of this protein can lead to inherited conditions such as Charcot-Marie-Tooth disease suggesting its essential role in neurological health and integrity.

Specifications

Form

Liquid

Additional notes

ab111640 is purified using conventional chromatography.

General info

Function

Translation regulator forming a complex with MCTS1 to promote translation reinitiation. Translation reinitiation is the process where the small ribosomal subunit remains attached to the mRNA following termination of translation of a regulatory upstream ORF (uORF), and resume scanning on the same mRNA molecule to initiate translation of a downstream ORF, usually the main ORF (mORF). The MCTS1/DENR complex is pivotal to two linked mechanisms essential for translation reinitiation. Firstly, the dissociation of deacylated tRNAs from post-termination 40S ribosomal complexes during ribosome recycling. Secondly, the recruitment in an EIF2-independent manner of aminoacylated initiator tRNA to P site of 40S ribosomes for a new round of translation. This regulatory mechanism governs the translation of more than 150 genes which translation reinitiation is MCTS1/DENR complex-dependent.

Sequence similarities

Belongs to the DENR family.

Product protocols

Target data

Translation regulator forming a complex with MCTS1 to promote translation reinitiation. Translation reinitiation is the process where the small ribosomal subunit remains attached to the mRNA following termination of translation of a regulatory upstream ORF (uORF), and resume scanning on the same mRNA molecule to initiate translation of a downstream ORF, usually the main ORF (mORF). The MCTS1/DENR complex is pivotal to two linked mechanisms essential for translation reinitiation. Firstly, the dissociation of deacylated tRNAs from post-termination 40S ribosomal complexes during ribosome recycling. Secondly, the recruitment in an EIF2-independent manner of aminoacylated initiator tRNA to P site of 40S ribosomes for a new round of translation. This regulatory mechanism governs the translation of more than 150 genes which translation reinitiation is MCTS1/DENR complex-dependent.
See full target information DENR

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com