JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB78682

Recombinant Human Dhh protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Dhh protein (His tag N-Terminus) is a Human Fragment protein, in the 23 to 198 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

Desert hedgehog protein, DHH, HHG-3

1 Images
SDS-PAGE - Recombinant Human Dhh protein (His tag N-Terminus) (AB78682)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Dhh protein (His tag N-Terminus) (AB78682)

15% SDS-PAGE showing ab78682 at approximately 22kDa (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O43323

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 5.5 Constituents: 20% Glycerol (glycerin, glycerine), 0.39% MES, 0.0077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":198,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O43323","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein 'Desert Hedgehog' (Dhh) also known as DHH weighs approximately 42 kDa and plays an important role in signaling pathways. Dhh functions mechanically by sending signals that control cell growth and differentiation during embryonic development. This protein expresses in specific tissues such as the gonads and is especially associated with Sertoli cells in the testes.
Biological function summary

Dhh contributes to the regulation of morphogenesis and tissue patterning. Dhh forms part of the Hedgehog signaling pathway a critical signaling complex needed for the communication between cells. This interaction is important for cellular processes such as growth survival and differentiation. The protein is critical in development and is significant for the proper formation of various organs and tissues.

Pathways

Its involvement with the Hedgehog signaling pathway is essential. This pathway impacts the development of several structures and organs by regulating gene expression. Other proteins involved in this pathway include Patched1 (PTCH1) and Smoothened (SMO). Pathway deregulation can lead to issues and is a significant area of study in several types of biological research.

Dhh has links to conditions like gonadal dysgenesis and peripheral neuropathy. Abnormal function or expression of the Dhh protein can lead to developmental defects or contribute toward disease progression. The interaction with other proteins such as PTCH1 further highlights its involvement in the pathogenesis of these conditions. Understanding Dhh’s role offers potential insights into therapeutic interventions for these diseases.

Specifications

Form

Liquid

Additional notes

ab78682 is purified using conventional chromatography techniques.

General info

Function

Desert hedgehog protein. The C-terminal part of the desert hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts (N-product and C-product) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Both activities occur in the reticulum endoplasmic (By similarity). Functions in cell-cell mediated juxtacrine signaling (PubMed : 24342078). Promotes endothelium integrity (PubMed : 33063110). Binds to PTCH1 receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes in endothelial cells (PubMed : 33063110). In Schwann cells, controls the development of the peripheral nerve sheath and the transition of mesenchymal cells to form the epithelium-like structure of the perineurial tube (By similarity).. Desert hedgehog protein N-product. The dually lipidated desert hedgehog protein N-product is essential for a variety of patterning events during development (By similarity). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PubMed : 11472839, PubMed : 33063110). Required for normal testis development and spermatogenesis, namely for the formation of adult-type Leydig cells and normal development of peritubular cells and seminiferous tubules (By similarity). Activates primary cilia signaling on neighboring valve interstitial cells through a paracrine mechanism (By similarity). May induce motor neurons in lateral neural tube and may have a polarizing activity (PubMed : 11472839). Prevents the desert hedgehog protein precursor binding to PTCH1 (PubMed : 33063110).

Sequence similarities

Belongs to the hedgehog family.

Post-translational modifications

Desert hedgehog protein. Partially autoproteolyzed (PubMed:24342078, PubMed:30298535). The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (DhhN) (By similarity).. Desert hedgehog protein N-product. N-palmitoylation by HHAT of DhhN is required for desert hedgehog protein N-product multimerization and full activity (By similarity).

Product protocols

Target data

Desert hedgehog protein. The C-terminal part of the desert hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts (N-product and C-product) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Both activities occur in the reticulum endoplasmic (By similarity). Functions in cell-cell mediated juxtacrine signaling (PubMed : 24342078). Promotes endothelium integrity (PubMed : 33063110). Binds to PTCH1 receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes in endothelial cells (PubMed : 33063110). In Schwann cells, controls the development of the peripheral nerve sheath and the transition of mesenchymal cells to form the epithelium-like structure of the perineurial tube (By similarity).. Desert hedgehog protein N-product. The dually lipidated desert hedgehog protein N-product is essential for a variety of patterning events during development (By similarity). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PubMed : 11472839, PubMed : 33063110). Required for normal testis development and spermatogenesis, namely for the formation of adult-type Leydig cells and normal development of peritubular cells and seminiferous tubules (By similarity). Activates primary cilia signaling on neighboring valve interstitial cells through a paracrine mechanism (By similarity). May induce motor neurons in lateral neural tube and may have a polarizing activity (PubMed : 11472839). Prevents the desert hedgehog protein precursor binding to PTCH1 (PubMed : 33063110).
See full target information DHH

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Nature 605:509-515 PubMed35545674

2022

Young CSF restores oligodendrogenesis and memory in aged mice via Fgf17.

Applications

Unspecified application

Species

Unspecified reactive species

Tal Iram,Fabian Kern,Achint Kaur,Saket Myneni,Allison R Morningstar,Heather Shin,Miguel A Garcia,Lakshmi Yerra,Robert Palovics,Andrew C Yang,Oliver Hahn,Nannan Lu,Steven R Shuken,Michael S Haney,Benoit Lehallier,Manasi Iyer,Jian Luo,Henrik Zetterberg,Andreas Keller,J Bradley Zuchero,Tony Wyss-Coray
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com