JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB116155

Recombinant Human DHRS4 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DHRS4 protein is a Human Full Length protein, in the 1 to 278 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

SDR25C2, UNQ851/PRO1800, DHRS4, Dehydrogenase/reductase SDR family member 4, NADPH-dependent carbonyl reductase, NADPH-dependent retinol dehydrogenase/reductase, Peroxisomal short-chain alcohol dehydrogenase, SCAD-SRL, Short chain dehydrogenase/reductase family 25C member 2, Short-chain dehydrogenase/reductase family member 4, CR, NRDR, humNRDR, PSCD, Protein SDR25C2

1 Images
SDS-PAGE - Recombinant Human DHRS4 protein (AB116155)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human DHRS4 protein (AB116155)

15% SDS-PAGE showing ab116155 at approximately 32.1kDa (3μg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9BTZ2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 20% Glycerol (glycerin, glycerine), 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMMHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL","proteinLength":"Full Length","predictedMolecularWeight":"32.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":278,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9BTZ2","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

DHRS4 also known as Dehydrogenase/Reductase SDR Family Member 4 plays an important role in metabolic processes. This enzyme with a mass of approximately 36 kDa primarily engages in oxidoreductive activities affecting the metabolism of steroids and retinoids. Its expression is particularly high in the liver but can also be found in lung and kidney tissues. The protein facilitates the conversion of aldehydes and ketones into their corresponding alcohols influencing metabolic pathways significantly.
Biological function summary

The dehydrogenase/reductase family member 4 interacts with multiple substrates impacting cellular redox status. This protein is not known to be part of a larger complex but interacts dynamically with other molecules within the cell. It contributes notably to the synthesis and breakdown of retinoic acids which are essential for cellular differentiation and growth. By managing retinoic acid levels DHRS4 helps regulate gene expression and various cellular responses.

Pathways

DHRS4 integrates into the retinoid metabolism and transport pathway as well as the steroid hormone biosynthesis pathway. It works alongside proteins such as retinol-binding protein 4 (RBP4) in retinoid metabolism influencing the availability and activity of retinoic acids. The interplay of DHRS4 with these pathways indicates its role in maintaining homeostasis of important biochemical processes in the body affecting energy metabolism and hormone regulation.

DHRS4 has been linked to metabolic disorders including hepatic diseases due to its role in lipid metabolism. Alterations in DHRS4 expression or function may contribute to fatty liver disease through disrupted retinoid processing. Additionally its involvement in steroid metabolism indicates possible connections to endocrine disorders occasionally interacting with cytochrome P450 enzymes which further impacts hormone synthesis and balance. The enzyme's importance in managing metabolic activities highlights its relevance in disease contexts.

Specifications

Form

Liquid

Additional notes

ab116155 was purified using conventional chromatography techniques.

General info

Function

NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including ketosteroids, alpha-dicarbonyl compounds, aldehydes, aromatic ketones and quinones (PubMed : 18571493, PubMed : 19056333). Reduces 3-ketosteroids and benzil into 3beta-hydroxysteroids and R-benzoin, respectively, in contrast to the stereoselectivity of non-primate DHRS4s which produce 3alpha-hydroxysteroids and S-benzoin (PubMed : 19056333). Diplays low activity toward all-trans-retinal and no activity toward 9-cis-retinal as compared to non-primate mammals (PubMed : 18571493, PubMed : 19056333). In the reverse reaction, catalyze the NAD-dependent oxidation of 3beta-hydroxysteroids and alcohol, but with much lower efficiency (PubMed : 18571493, PubMed : 19056333). Involved in the metabolism of 3beta-hydroxysteroids, isatin and xenobiotic carbonyl compounds (PubMed : 18571493, PubMed : 19056333).. Isoform 7. No detected catalytic activity in vitro, possibly due to the lack of catalytic site.. Isoform 8. NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including ketosteroids, alpha-dicarbonyl compounds, aldehydes, aromatic ketones and quinones. Involved in the metabolism of 3beta-hydroxysteroids, isatin and xenobiotic carbonyl compounds. Has a higher catalytic activity for xenobiotic alpha-dicarbonyl compounds, sucha as benzil, than isoform 1 and is involved in benzil detoxification.

Sequence similarities

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Subcellular localisation

Peroxisome

Product protocols

Target data

NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including ketosteroids, alpha-dicarbonyl compounds, aldehydes, aromatic ketones and quinones (PubMed : 18571493, PubMed : 19056333). Reduces 3-ketosteroids and benzil into 3beta-hydroxysteroids and R-benzoin, respectively, in contrast to the stereoselectivity of non-primate DHRS4s which produce 3alpha-hydroxysteroids and S-benzoin (PubMed : 19056333). Diplays low activity toward all-trans-retinal and no activity toward 9-cis-retinal as compared to non-primate mammals (PubMed : 18571493, PubMed : 19056333). In the reverse reaction, catalyze the NAD-dependent oxidation of 3beta-hydroxysteroids and alcohol, but with much lower efficiency (PubMed : 18571493, PubMed : 19056333). Involved in the metabolism of 3beta-hydroxysteroids, isatin and xenobiotic carbonyl compounds (PubMed : 18571493, PubMed : 19056333).. Isoform 7. No detected catalytic activity in vitro, possibly due to the lack of catalytic site.. Isoform 8. NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including ketosteroids, alpha-dicarbonyl compounds, aldehydes, aromatic ketones and quinones. Involved in the metabolism of 3beta-hydroxysteroids, isatin and xenobiotic carbonyl compounds. Has a higher catalytic activity for xenobiotic alpha-dicarbonyl compounds, sucha as benzil, than isoform 1 and is involved in benzil detoxification.
See full target information DHRS4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com