JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB103915

Recombinant Human DIPP protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DIPP protein is a Human Full Length protein, in the 1 to 172 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

DIPP, DIPP1, NUDT3, Diphosphoinositol polyphosphate phosphohydrolase 1, DIPP-1, Diadenosine hexaphosphate hydrolase, Endopolyphosphatase, Nucleoside diphosphate-linked moiety X motif 3, m7GpppN-mRNA hydrolase, m7GpppX diphosphatase, Ap6A hydrolase, Nudix motif 3

1 Images
SDS-PAGE - Recombinant Human DIPP protein (AB103915)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human DIPP protein (AB103915)

15% SDS-PAGE analysis of ab103915 (3 μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

O95989

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as NUDT3.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR","proteinLength":"Full Length","predictedMolecularWeight":"21.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":172,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O95989","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

DIPP also known as a Diadenosine triphosphate hydrolase (Ap3Aase) acts mechanically as a nucleoside triphosphate diphosphohydrolase. It hydrolyzes nucleoside diphosphates such as Ap3A. DIPP has a molecular mass of approximately 41 kDa. It expresses in various tissues including the brain kidney and liver suggesting its involvement in essential biochemical processes.
Biological function summary

DIPP regulates the concentration of diadenosine polyphosphates which act as signaling molecules in cellular communication. These molecules control intracellular and extracellular nucleotide levels. DIPP sometimes forms part of a protein complex that modulates signal transduction pathways emphasizing its role in cellular homeostasis and signaling.

Pathways

DIPP integrates into the purinergic signaling pathway and it contributes to the regulation of energy metabolism. This protein interacts with other hydrolases and kinases influencing ATP degradation and synthesis. Through this interaction it plays a role with proteins like NTPDases highlighting its significance in nucleotide management.

DIPP contributes to diseases related to abnormal nucleotide levels such as cancer and neurological disorders. In cancer altered DIPP activity relates to dysregulation of cellular energy balance. Additionally in neurological disorders DIPP's interaction with proteins like Ap3A-binding proteins might affect synaptic transmission and neuronal function illustrating its involvement in neuronal health.

Specifications

Form

Liquid

Additional notes

Purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction (PubMed : 10585413, PubMed : 12370170, PubMed : 9822604). InsP6 (inositol hexakisphosphate) is not a substrate (PubMed : 9822604). Acts as a negative regulator of the ERK1/2 pathway (By similarity). Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with diadenosine 5',5'''-P1,P6-hexaphosphate (Ap6A) and diadenosine 5',5'''- P1,P5-pentaphosphate (Ap5A) being the preferred substrates (PubMed : 10419486, PubMed : 12370170). The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A (PubMed : 12370170). Also able to hydrolyze 5-phosphoribose 1-diphosphate (PubMed : 12370170). Acts as a decapping enzyme that modulates the stability of a subset of mRNAs implicated in cell motility (PubMed : 26932476). Hydrolyzes monomethylated capped RNA after both the alpha- and beta-phosphates generating m7GMP + ppRNA and m7GDP + pRNA (PubMed : 32727897). Can hydrolyze unmethylated capped RNAs (By similarity). Divalent cations zinc, magnesium and manganese determine its substrate specificity (PubMed : 34788624). Exhibits diphosphoinositol polyphosphate phosphohydrolase in the presence of magnesium ions, diadenosine hexaphosphate hydrolase activity in the presence of manganese ions and endopolyphosphatase activity in the presence of zinc ions (PubMed : 34788624). Plays an important role in limiting DNA damage and maintaining cell survival upon oxidative stress via its endopolyphosphatase activity (PubMed : 34788624).

Sequence similarities

Belongs to the Nudix hydrolase family. DIPP subfamily.

Product protocols

Target data

Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction (PubMed : 10585413, PubMed : 12370170, PubMed : 9822604). InsP6 (inositol hexakisphosphate) is not a substrate (PubMed : 9822604). Acts as a negative regulator of the ERK1/2 pathway (By similarity). Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with diadenosine 5',5'''-P1,P6-hexaphosphate (Ap6A) and diadenosine 5',5'''- P1,P5-pentaphosphate (Ap5A) being the preferred substrates (PubMed : 10419486, PubMed : 12370170). The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A (PubMed : 12370170). Also able to hydrolyze 5-phosphoribose 1-diphosphate (PubMed : 12370170). Acts as a decapping enzyme that modulates the stability of a subset of mRNAs implicated in cell motility (PubMed : 26932476). Hydrolyzes monomethylated capped RNA after both the alpha- and beta-phosphates generating m7GMP + ppRNA and m7GDP + pRNA (PubMed : 32727897). Can hydrolyze unmethylated capped RNAs (By similarity). Divalent cations zinc, magnesium and manganese determine its substrate specificity (PubMed : 34788624). Exhibits diphosphoinositol polyphosphate phosphohydrolase in the presence of magnesium ions, diadenosine hexaphosphate hydrolase activity in the presence of manganese ions and endopolyphosphatase activity in the presence of zinc ions (PubMed : 34788624). Plays an important role in limiting DNA damage and maintaining cell survival upon oxidative stress via its endopolyphosphatase activity (PubMed : 34788624).
See full target information NUDT3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com