JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB155623

Recombinant human DKK1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human DKK1 protein is a Human Full Length protein, in the 32 to 266 aa range, with >95% purity, < 1 EU/µg endotoxin level and suitable for SDS-PAGE and Functional studies. The predicted molecular weight of ab155623 protein is 28.5 kDa.

- Save time and ensure accurate results - use our DKK-1 protein as a control
- Optimal protein bioactivity, stability and reproducibility

View Alternative Names

UNQ492/PRO1008, DKK1, Dickkopf-related protein 1, Dickkopf-1, Dkk-1, hDkk-1, SK

3 Images
Functional Studies - Recombinant human DKK1 protein (AB155623)
  • FuncS

Supplier Data

Functional Studies - Recombinant human DKK1 protein (AB155623)

Immobilized Hab155623 at 5 μg/mL (100 μL/well) can bind Human LRP-5, Mouse IgG2a Fc Tag with a linear range of 0.01-0.156 μg/mL

SDS-PAGE - Recombinant human DKK1 protein (AB155623)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human DKK1 protein (AB155623)

SDS-PAGE analysis of reduced ab155623 stained overnight with Coomassie Blue.

SDS-PAGE - Recombinant human DKK1 protein (AB155623)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human DKK1 protein (AB155623)

Human Dkk-1 (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Measured by the ability to inhibit Wnt3-a induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is typically 0.01-0.12 µg/ml in the presence of 10 ng/ml of rmWnt3a.

Accession

O94907

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute with sterile deionized water to a concentration of 200 µg/ml.

Storage buffer

pH: 7.4 Constituents: PBS, 5% Trehalose

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>DTT-reduced ab155623 migrates as 40 kDa protein due to glycosylation.</p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our bioactive recombinant human DKK-1 protein ab155623 as a positive control in SDS-PAGE.

The human DKK-1 protein has a calculated MW of 28.5 kDa. The ab155623 protein migrates as 35 - 45 kDa under reducing condition in SDS-PAGE due to glycosylation.


Check out our protein gel staining guide for SDS-PAGE here

Sequence info

[{"sequence":"TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH","proteinLength":"Full Length","predictedMolecularWeight":"25.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":266,"aminoAcidStart":32,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O94907","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The DKK1 protein also known as Dickkopf-1 is a secreted protein with a mass of approximately 28-30 kDa. It plays a mechanical role in inhibiting the Wnt signaling pathway by binding to LRP5/6 co-receptors preventing Wnt ligands from activating the pathway. DKK1 is expressed in various tissues including the bone brain and placenta reflecting its involvement in several biological processes. Its capacity to bind and neutralize the Wnt pathway components cements DKK1's role as a significant modulator of cellular functions.
Biological function summary

The inhibition of the Wnt signaling by DKK1 alters cell proliferation differentiation and migration. DKK1 does not function as part of a large multi-protein complex but interacts directly with specific co-receptors and modulates the activity of key signaling molecules. This regulatory mechanism controls processes like bone formation and neurogenesis indicating DKK1's broad impact in development and tissue homeostasis. Its expression pattern and biological role position it as an important player in maintaining proper cellular signaling environments.

Pathways

DKK1 is a critical player in the Wnt signaling and bone remodeling pathways. Through its interaction with Wnt pathway components like LRP5/6 DKK1 modulates these pathways affecting downstream proteins such as β-catenin and influencing gene transcription. In the bone remodeling context DKK1's ability to regulate osteoblast activity connects it to other related proteins like sclerostin contributing to bone density and health.

Elevated levels of DKK1 are observed in conditions like osteoporosis and cancer. In osteoporosis DKK1's inhibition of Wnt signaling leads to reduced bone formation implicating it alongside proteins like sclerostin in deteriorating bone health. In cancer DKK1's dysregulation can promote tumorigenesis by altering cell signaling and microenvironment interactions. These roles underline the potential of targeting DKK1 for therapeutic purposes in treating these diseases.

Specifications

Form

Lyophilized

Additional notes

Purified by Immobilized metal affinity chromatography.

General info

Function

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6 (PubMed : 22000856). DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (PubMed : 17143291). Inhibits the pro-apoptotic function of KREMEN1 in a Wnt-independent manner, and has anti-apoptotic activity (By similarity).

Sequence similarities

Belongs to the dickkopf family.

Product protocols

Target data

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6 (PubMed : 22000856). DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (PubMed : 17143291). Inhibits the pro-apoptotic function of KREMEN1 in a Wnt-independent manner, and has anti-apoptotic activity (By similarity).
See full target information DKK1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com