JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114867

Recombinant Human DMBT1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DMBT1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 1377 to 1485 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA.

View Alternative Names

GP340, DMBT1, Scavenger receptor cysteine-rich domain-containing protein DMBT1, Deleted in malignant brain tumors 1 protein, Glycoprotein 340, Hensin, Salivary agglutinin, Surfactant pulmonary-associated D-binding protein, Gp-340, SAG

1 Images
SDS-PAGE - Recombinant Human DMBT1 protein (GST tag N-Terminus) (AB114867)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human DMBT1 protein (GST tag N-Terminus) (AB114867)

ab114867 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE

applications

Biologically active

No

Accession

Q9UGM3

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as gp340.

Sequence info

[{"sequence":"DYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFISDHSITRRGFRAE","proteinLength":"Fragment","predictedMolecularWeight":"37.62 kDa","actualMolecularWeight":null,"aminoAcidEnd":1485,"aminoAcidStart":1377,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9UGM3","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The DMBT1 protein also known as Deleted in Malignant Brain Tumors 1 plays an important role in the human immune response and tissue homeostasis. It has a molecular mass of approximately 340 kDa. The protein expresses in numerous tissues such as the respiratory tract gastrointestinal tract and reproductive organs suggesting its involvement in various physiological processes. DMBT1 expresses abundantly in epithelial cells where it is also secreted into body fluids.
Biological function summary

The DMBT1 protein acts as a pattern recognition receptor (PRR) which means it identifies and binds to pathogen-associated molecular patterns. This function helps in the elimination of pathogens and maintaining mucosal immunity. DMBT1 is not typically part of a larger stable protein complex but it interacts with other PRRs to enhance protective responses. It helps balance between immune defense and inflammation indicating its adaptive role in immunity.

Pathways

The Dmbt1 protein interacts significantly with the immune and inflammatory pathways. It is involved in the Toll-like receptor (TLR) signaling pathway which is important in recognizing microbial components and activating immune responses. Additionally DMBT1 has interactions with the NF-kB pathway which controls inflammatory reactions and immune response. Proteins involved in these pathways related to DMBT1 include TLR4 and MyD88 indicating its role in modulating immune responses.

The Dmbt1 protein is linked to cancer and inflammatory diseases. In certain cancers such as brain and lung cancer it functions as a tumor suppressor. Loss or alteration of the DMBT1 gene can result in reduced immune surveillance leading to tumor progression. It also relates to inflammatory bowel disease where altered DMBT1 expression contributes to intestinal inflammation. Proteins like TLR4 with which DMBT1 interacts are implicated in both cancer and chronic inflammatory responses highlighting their interconnected roles.

Specifications

Form

Liquid

General info

Function

May be considered as a candidate tumor suppressor gene for brain, lung, esophageal, gastric, and colorectal cancers. May play roles in mucosal defense system, cellular immune defense and epithelial differentiation. May play a role as an opsonin receptor for SFTPD and SPAR in macrophage tissues throughout the body, including epithelial cells lining the gastrointestinal tract. May play a role in liver regeneration. May be an important factor in fate decision and differentiation of transit-amplifying ductular (oval) cells within the hepatic lineage. Required for terminal differentiation of columnar epithelial cells during early embryogenesis. May function as a binding protein in saliva for the regulation of taste sensation. Binds to HIV-1 envelope protein and has been shown to both inhibit and facilitate viral transmission. Displays a broad calcium-dependent binding spectrum against both Gram-positive and Gram-negative bacteria, suggesting a role in defense against bacterial pathogens. Binds to a range of poly-sulfated and poly-phosphorylated ligands which may explain its broad bacterial-binding specificity. Inhibits cytoinvasion of S.enterica. Associates with the actin cytoskeleton and is involved in its remodeling during regulated exocytosis. Interacts with pancreatic zymogens in a pH-dependent manner and may act as a Golgi cargo receptor in the regulated secretory pathway of the pancreatic acinar cell.

Sequence similarities

Belongs to the DMBT1 family.

Post-translational modifications

Highly N- and O-glycosylated. The O-glycans are heavily sulfated (By similarity).

Product protocols

Target data

May be considered as a candidate tumor suppressor gene for brain, lung, esophageal, gastric, and colorectal cancers. May play roles in mucosal defense system, cellular immune defense and epithelial differentiation. May play a role as an opsonin receptor for SFTPD and SPAR in macrophage tissues throughout the body, including epithelial cells lining the gastrointestinal tract. May play a role in liver regeneration. May be an important factor in fate decision and differentiation of transit-amplifying ductular (oval) cells within the hepatic lineage. Required for terminal differentiation of columnar epithelial cells during early embryogenesis. May function as a binding protein in saliva for the regulation of taste sensation. Binds to HIV-1 envelope protein and has been shown to both inhibit and facilitate viral transmission. Displays a broad calcium-dependent binding spectrum against both Gram-positive and Gram-negative bacteria, suggesting a role in defense against bacterial pathogens. Binds to a range of poly-sulfated and poly-phosphorylated ligands which may explain its broad bacterial-binding specificity. Inhibits cytoinvasion of S.enterica. Associates with the actin cytoskeleton and is involved in its remodeling during regulated exocytosis. Interacts with pancreatic zymogens in a pH-dependent manner and may act as a Golgi cargo receptor in the regulated secretory pathway of the pancreatic acinar cell.
See full target information DMBT1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com