JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159014

Recombinant Human DMT1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DMT1 protein is a Human Fragment protein, in the 1 to 65 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

DCT1, DMT1, NRAMP2, OK/SW-cl.20, SLC11A2, Natural resistance-associated macrophage protein 2, NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, Solute carrier family 11 member 2, DMT-1

1 Images
SDS-PAGE - Recombinant Human DMT1 protein (AB159014)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human DMT1 protein (AB159014)

ab159014 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P49281

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

You may be interested in:

AB83366

Iron Assay Kit (Colorimetric)

4

3 Reviews

View product

We recommend this product because it’s often used in the same experiment or related research.

We advise that you always check the datasheet to ensure it fits your experiments, or contact ourtechnical teamfor help.

Sequence info

[{"sequence":"MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":65,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P49281","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The DMT1 protein also known as divalent metal transporter 1 or NRAMP2 functions as an essential transporter for divalent metal ions including iron and manganese. DMT1 has a molecular mass around 65 kDa and is expressed widely in tissues like the intestine liver and brain where it facilitates the uptake of these ions. In the gut it plays a significant role in iron absorption from dietary sources. DMT1 protein contributes to maintaining systemic iron levels important for many physiological processes.
Biological function summary

DMT1 facilitates cellular uptake of iron important for oxygen transport and DNA synthesis. As part of its function DMT1 operates independently not as a component of a larger protein complex enabling it to transport metal ions across cell membranes directly. This process ensures that cells receive necessary ions for their metabolic activities and energy production aiding in cellular homeostasis.

Pathways

DMT1 integrates into important biological systems like the iron metabolism pathway and the manganese transport pathway. It works alongside ferritin a protein responsible for storing iron within cells to regulate iron availability and prevent toxicity. Similarly its role in the manganese transport pathway helps maintain manganese homeostasis which protease enzymes and neurotransmitter synthesis rely on.

DMT1 shows significant relevance to iron overload conditions such as hemochromatosis and neurodegenerative diseases like Parkinson’s disease. Mutations or dysregulation in DMT1 expression can lead to improper iron accumulation contributing to oxidative stress and neuronal damage respectively. Its role in iron uptake and regulation therefore connects it with proteins like hepcidin influential in maintaining iron balance impacting these conditions.

Specifications

Form

Liquid

General info

Function

Proton-coupled metal ion symporter operating with a proton to metal ion stoichiometry of 1 : 1 (PubMed : 17109629, PubMed : 17293870, PubMed : 22736759, PubMed : 25326704, PubMed : 25491917). Selectively transports various divalent metal cations, in decreasing affinity : Cd(2+) > Fe(2+) > Co(2+), Mn(2+) >> Zn(2+), Ni(2+), VO(2+) (PubMed : 17109629, PubMed : 17293870, PubMed : 22736759, PubMed : 25326704, PubMed : 25491917). Essential for maintenance of iron homeostasis by modulating intestinal absorption of dietary Fe(2+) and TF-associated endosomal Fe(2+) transport in erythroid precursors and other cells (By similarity). Enables Fe(2+) and Mn(2+) ion entry into mitochondria, and is thus expected to promote mitochondrial heme synthesis, iron-sulfur cluster biogenesis and antioxidant defense (By similarity) (PubMed : 24448823). Can mediate uncoupled fluxes of either protons or metal ions.

Sequence similarities

Belongs to the NRAMP family.

Post-translational modifications

Ubiquitinated by WWP2.. N-glycosylated.

Subcellular localisation

Early endosome

Product protocols

For this product, it's our understanding that no specific protocols are required. You can visit:

Target data

Proton-coupled metal ion symporter operating with a proton to metal ion stoichiometry of 1 : 1 (PubMed : 17109629, PubMed : 17293870, PubMed : 22736759, PubMed : 25326704, PubMed : 25491917). Selectively transports various divalent metal cations, in decreasing affinity : Cd(2+) > Fe(2+) > Co(2+), Mn(2+) >> Zn(2+), Ni(2+), VO(2+) (PubMed : 17109629, PubMed : 17293870, PubMed : 22736759, PubMed : 25326704, PubMed : 25491917). Essential for maintenance of iron homeostasis by modulating intestinal absorption of dietary Fe(2+) and TF-associated endosomal Fe(2+) transport in erythroid precursors and other cells (By similarity). Enables Fe(2+) and Mn(2+) ion entry into mitochondria, and is thus expected to promote mitochondrial heme synthesis, iron-sulfur cluster biogenesis and antioxidant defense (By similarity) (PubMed : 24448823). Can mediate uncoupled fluxes of either protons or metal ions.
See full target information SLC11A2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com