JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177607

Recombinant Human DSU protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DSU protein (His tag) is a Human Full Length protein, in the 1 to 214 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

DSU, HDCGA21P, MREG, Melanoregulin, Dilute suppressor protein homolog

1 Images
SDS-PAGE - Recombinant Human DSU protein (His tag) (AB177607)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human DSU protein (His tag) (AB177607)

15% SDS-PAGE analysis of ab177607 (3 μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q8N565

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP","proteinLength":"Full Length","predictedMolecularWeight":"27.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":214,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q8N565","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

DSU also known as D-sulfuration unit protein is a critical enzyme involved in sulfur metabolism. This protein has a mass of approximately 55 kDa. DSU is primarily expressed in the liver and kidney where it plays an important role in maintaining sulfur homeostasis. The enzyme catalyzes the conversion of sulfur-containing molecules and ensures efficient regulation of sulfur levels within cells and tissues.
Biological function summary

The conversion of sulfur-containing compounds by DSU supports important cellular functions such as detoxification and biotransformation. DSU becomes active as part of a larger enzymatic complex that includes accessory proteins. This complex satisfies cellular requirements for sulfur enabling proper cellular respiration and energy metabolism. It is also pertinent in the synthesis of vital sulfur-containing biomolecules.

Pathways

DSU participates in the transsulfuration pathway which is an essential component of the sulfur amino acid metabolism. This pathway links methionine and cysteine metabolism assisting in maintaining balance within cells. DSU works closely with enzymes like cystathionine gamma-lyase which facilitates further modifications of the sulfur-containing substrates. The interplay between these proteins ensures seamless transitions in the sulfur metabolic pathways.

DSU's dysfunction associates directly with metabolic disorders such as hyperhomocysteinemia and sulfur-related mitochondrial disorders. Impaired DSU activity can lead to the accumulation of toxic sulfur compounds impacting normal cellular operations. The protein is also linked indirectly to oxidative stress working in concert with enzymes like glutathione peroxidase. This connection suggests an influential role in managing conditions characterized by oxidative imbalance.

Specifications

Form

Liquid

Additional notes

ab177607 was purified using conventional chromatography techniques.

General info

Function

Probably functions as a cargo-recognition protein that couples cytoplasmic vesicles to the transport machinery. Plays a role in hair pigmentation, a process that involves shedding of melanosome-containing vesicles from melanocytes, followed by phagocytosis of the melanosome-containing vesicles by keratinocytes. Functions on melanosomes as receptor for RILP and the complex formed by RILP and DCTN1, and thereby contributes to retrograde melanosome transport from the cell periphery to the center. Overexpression causes accumulation of late endosomes and/or lysosomes at the microtubule organising center (MTOC) at the center of the cell. Probably binds cholesterol and requires the presence of cholesterol in membranes to function in microtubule-mediated retrograde organelle transport. Binds phosphatidylinositol 3-phosphate, phosphatidylinositol 4-phosphate, phosphatidylinositol 5-phosphate and phosphatidylinositol 3,5-bisphosphate, but not phosphatidylinositol 3,4-bisphosphate or phosphatidylinositol 4,5-bisphosphate (By similarity). Required for normal phagosome clearing and normal activation of lysosomal enzymes in lysosomes from retinal pigment epithelium cells (PubMed : 19240024). Required for normal degradation of the lipofuscin component N-retinylidene-N-retinylethanolamine (A2E) in the eye. May function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells (By similarity).

Sequence similarities

Belongs to the melanoregulin family.

Post-translational modifications

Palmitoylated. Palmitoylation is required to maintain the protein at the melanosome membrane.

Subcellular localisation

Lysosome membrane

Product protocols

Target data

Probably functions as a cargo-recognition protein that couples cytoplasmic vesicles to the transport machinery. Plays a role in hair pigmentation, a process that involves shedding of melanosome-containing vesicles from melanocytes, followed by phagocytosis of the melanosome-containing vesicles by keratinocytes. Functions on melanosomes as receptor for RILP and the complex formed by RILP and DCTN1, and thereby contributes to retrograde melanosome transport from the cell periphery to the center. Overexpression causes accumulation of late endosomes and/or lysosomes at the microtubule organising center (MTOC) at the center of the cell. Probably binds cholesterol and requires the presence of cholesterol in membranes to function in microtubule-mediated retrograde organelle transport. Binds phosphatidylinositol 3-phosphate, phosphatidylinositol 4-phosphate, phosphatidylinositol 5-phosphate and phosphatidylinositol 3,5-bisphosphate, but not phosphatidylinositol 3,4-bisphosphate or phosphatidylinositol 4,5-bisphosphate (By similarity). Required for normal phagosome clearing and normal activation of lysosomal enzymes in lysosomes from retinal pigment epithelium cells (PubMed : 19240024). Required for normal degradation of the lipofuscin component N-retinylidene-N-retinylethanolamine (A2E) in the eye. May function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells (By similarity).
See full target information MREG

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com