JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112436

Recombinant Human Dub3 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Dub3 protein (GST tag N-Terminus) is a Human Fragment protein, in the 431 to 530 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

DUB3, USP17, USP17H, USP17I, USP17J, USP17K, USP17L, USP17M, USP17L2, Ubiquitin carboxyl-terminal hydrolase 17, Deubiquitinating enzyme 17-like protein 2, Deubiquitinating protein 3, Ubiquitin carboxyl-terminal hydrolase 17-like protein 2, Ubiquitin thioesterase 17-like protein 2, Ubiquitin-specific-processing protease 17-like protein 2, DUB-3

1 Images
SDS-PAGE - Recombinant Human Dub3 protein (GST tag N-Terminus) (AB112436)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Dub3 protein (GST tag N-Terminus) (AB112436)

12.5% SDS-PAGE showing ab112436 at approximately 36.63kDa stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

Q6R6M4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein)</p>" } } }

Sequence info

[{"sequence":"ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":530,"aminoAcidStart":431,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q6R6M4","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Dub3 also known as Deubiquitinase 3 is an enzyme that acts as a deubiquitinating enzyme (DUB). This enzyme removes ubiquitin from proteins an important process in regulating protein stability and function. Dub3 has a molecular mass of approximately 59 kDa and is expressed in various tissues including high expression in the uterus placenta and testis. Its activity is important for maintaining proper levels of cellular proteins by reversing the ubiquitination process.
Biological function summary

Deubiquitinase 3 plays a significant role in regulating cell cycle progression and DNA damage response. It is often found within a larger complex where it interacts with other proteins to exert its function. This enzyme modulates the activity of several key proteins such as Cyclin A and Cdc25A by controlling their ubiquitination status which influences cell division and repair mechanisms in the cell. By maintaining these processes Dub3 ensures the fidelity of the cell cycle and genomic integrity.

Pathways

The function of Dub3 integrates into the ubiquitin-proteasome system and the DNA damage repair pathway. In the ubiquitin-proteasome system Dub3 removes ubiquitin chains from target proteins which determines their fate either for degradation or stabilization. On the DNA damage repair front Dub3 contributes to pathways involving proteins like p53 by deubiquitinating and stabilizing them allowing for an adequate response to DNA damage signals and maintaining cellular homeostasis.

Dub3 has been linked to certain cancers such as breast cancer and prostate cancer. In these cases its dysregulation leads to abnormal protein stabilization that can promote tumorigenesis. Dub3 affects oncogenic pathways involving proteins such as MYC and p53 which show altered levels and activity in cancer. Understanding the role of Dub3 in these disorders enables researchers to consider it a potential therapeutic target providing insights into how its modulation might benefit treatment strategies.

Specifications

Form

Liquid

General info

Function

Deubiquitinating enzyme that removes conjugated ubiquitin from specific proteins to regulate different cellular processes. Regulates cell proliferation by deubiquitinating and inhibiting RCE1 thereby controlling the small GTPases NRAS and HRAS localization and activation. In parallel, mediates deubiquitination of CDC25A, preventing CDC25A degradation by the proteasome during the G1/S and G2/M phases promoting cell-cycle progression. Also regulates cell proliferation and apoptosis through deubiquitination of SUDS3 a regulator of histone deacetylation. Through activation of the Rho family GTPases RAC1A, CDC42 and RHOA, regulates cell migration. Through the cleavage of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains of the cytoplasmic innate immune receptors RIGI and IFIH1 stimulates the cellular response to viral infection.

Sequence similarities

Belongs to the peptidase C19 family. USP17 subfamily.

Subcellular localisation

Nucleus

Product protocols

Target data

Deubiquitinating enzyme that removes conjugated ubiquitin from specific proteins to regulate different cellular processes. Regulates cell proliferation by deubiquitinating and inhibiting RCE1 thereby controlling the small GTPases NRAS and HRAS localization and activation. In parallel, mediates deubiquitination of CDC25A, preventing CDC25A degradation by the proteasome during the G1/S and G2/M phases promoting cell-cycle progression. Also regulates cell proliferation and apoptosis through deubiquitination of SUDS3 a regulator of histone deacetylation. Through activation of the Rho family GTPases RAC1A, CDC42 and RHOA, regulates cell migration. Through the cleavage of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains of the cytoplasmic innate immune receptors RIGI and IFIH1 stimulates the cellular response to viral infection.
See full target information USP17L2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com