JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB101204

Recombinant Human DYNLL1/PIN protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human DYNLL1/PIN protein is a Human Full Length protein, in the 1 to 89 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

DLC1, DNCL1, DNCLC1, HDLC1, DYNLL1, 8 kDa dynein light chain, Dynein light chain LC8-type 1, Protein inhibitor of neuronal nitric oxide synthase, DLC8, PIN

1 Images
SDS-PAGE - Recombinant Human DYNLL1/PIN protein (AB101204)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human DYNLL1/PIN protein (AB101204)

ab101204 at 3 μg analysed by 15% SDS PAGE.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P63167

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as DYNLL1.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG","proteinLength":"Full Length","predictedMolecularWeight":"12.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":89,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P63167","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

Additional notes

purified by using conventional chromatography techniques

General info

Function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function (By similarity). Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules (By similarity). May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity). In addition to its role in cytoskeleton and transport, acts as a protein-protein adapter, which inhibits and/or sequesters target proteins (PubMed : 10198631, PubMed : 15193260, PubMed : 15891768, PubMed : 16684779, PubMed : 30464262, PubMed : 37696958). Involved in the response to DNA damage by acting as a key regulator of DNA end resection : when phosphorylated at Ser-88, recruited to DNA double-strand breaks (DSBs) by TP53BP1 and acts by disrupting MRE11 dimerization, thereby inhibiting DNA end resection (PubMed : 30464262, PubMed : 37696958). In a subset of DSBs, DYNLL1 remains unphosphorylated and promotes the recruitment of the Shieldin complex (PubMed : 37696958). Binds and inhibits the catalytic activity of neuronal nitric oxide synthase/NOS1 (By similarity). Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1 (PubMed : 15891768, PubMed : 16684779). Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules (PubMed : 10198631, PubMed : 15193260). Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity (PubMed : 10198631, PubMed : 15193260).

Sequence similarities

Belongs to the dynein light chain family.

Post-translational modifications

Phosphorylation at Ser-88 promotes recruitment to DNA double-strand breaks (DSBs) by TP53BP1 and ability to inhibit MRE11 (PubMed:37696958). Phosphorylation at Ser-88 appears to control the dimer-monomer transition (PubMed:15193260, PubMed:18650427). According to PubMed:15193260, it is phosphorylated at Ser-88 by PAK1, however, according to PubMed:18650427, the DYNLL1 dimer is not accessible for PAK1 and the phosphorylation could not be demonstrated in vitro (PubMed:15193260, PubMed:18650427).

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function (By similarity). Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules (By similarity). May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity). In addition to its role in cytoskeleton and transport, acts as a protein-protein adapter, which inhibits and/or sequesters target proteins (PubMed : 10198631, PubMed : 15193260, PubMed : 15891768, PubMed : 16684779, PubMed : 30464262, PubMed : 37696958). Involved in the response to DNA damage by acting as a key regulator of DNA end resection : when phosphorylated at Ser-88, recruited to DNA double-strand breaks (DSBs) by TP53BP1 and acts by disrupting MRE11 dimerization, thereby inhibiting DNA end resection (PubMed : 30464262, PubMed : 37696958). In a subset of DSBs, DYNLL1 remains unphosphorylated and promotes the recruitment of the Shieldin complex (PubMed : 37696958). Binds and inhibits the catalytic activity of neuronal nitric oxide synthase/NOS1 (By similarity). Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1 (PubMed : 15891768, PubMed : 16684779). Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules (PubMed : 10198631, PubMed : 15193260). Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity (PubMed : 10198631, PubMed : 15193260).
See full target information DYNLL1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com