JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB269153

Recombinant Human EBI3 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human EBI3 protein is a Human Full Length protein, in the 21 to 229 aa range, expressed in Escherichia coli, with >90%, < 5 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

IL27B, EBI3, Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein

1 Images
SDS-PAGE - Recombinant Human EBI3 protein (AB269153)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human EBI3 protein (AB269153)

SDS-PAGE analysis of ab269153 at 1ug/lane under (-) non-reducing and (+) reducing conditions. 4-20% Tris glycine gel. Stained with coomassie blue.

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 5 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q14213

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 0.1 mg/mL in 10 mM HCl

Storage buffer

Constituents: 0.5% Mannitol, 0.1% Trifluoroacetic acid

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":229,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q14213","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C.
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EBI3 also known as Epstein-Barr virus induced 3 is a cytokine receptor protein with a molecular mass of approximately 34 kDa. This protein plays an important role in the immune system and is widely expressed in various tissues including spleen thymus and peripheral blood leukocytes. EBI3 is often found in cells involved in immune response such as macrophages and dendritic cells. It acts through the formation of heterodimers partnering with other proteins to exert its influence.
Biological function summary

EBI3 serves a function as a component of the cytokine complex. It pairs with other interleukin proteins forming essential heterodimers like IL-27 in which it combines with the cytokine p28. This complex is involved in modulating the immune response including the suppression and activation of T-cells. Through its binding actions EBI3 influences the regulation of immune responses aiding in controlling inflammation and maintaining immune system balance.

Pathways

EBI3 plays a critical role within the IL-27 signaling pathway. These pathways include the JAK/STAT signaling which is pivotal for mediating the immune response and influencing cell proliferation differentiation and apoptosis. EBI3 as part of the IL-27 complex interacts significantly with cytokines like IL-6 influencing the signal transduction pathways that are essential in immune cell communication and function.

EBI3 has associations with autoimmune diseases such as multiple sclerosis due to its role in regulating immune responses. Aberrant expression or function of EBI3 can contribute to the pathogenesis of chronic inflammatory diseases. It also holds potential links to cancer particularly in the modulation and development of tumor-induced immune evasion. In these disease contexts related proteins like p28 within the IL-27 complex interact with EBI3 affecting disease outcomes through their cooperative roles in immune modulation.

Specifications

Form

Lyophilized

Additional notes

nan

General info

Function

Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines.

Sequence similarities

Belongs to the type I cytokine receptor family. Type 3 subfamily.

Product protocols

Target data

Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines.
See full target information EBI3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com