JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259398

Recombinant human EGF protein (Active)

5

(2 Reviews)

|

(4 Publications)

Recombinant human EGF protein (Active) is a Human Full Length protein, in the 971 to 1023 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

Pro-epidermal growth factor, EGF

4 Images
Functional Studies - Recombinant human EGF protein (Active) (AB259398)
  • FuncS

Supplier Data

Functional Studies - Recombinant human EGF protein (Active) (AB259398)

Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of BALB / 3T3 cells is 0.99 ng/mL corresponding to a Specific Activity of 1.01 x 106 IU/mg.

Mass Spectrometry - Recombinant human EGF protein (Active) (AB259398)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human EGF protein (Active) (AB259398)

(M-Arg) +/- 0.1 Da (loss of C-terminal Arg; calc. mass 6123 Da)

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

SDS-PAGE - Recombinant human EGF protein (Active) (AB259398)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human EGF protein (Active) (AB259398)

SDS-PAGE analysis of ab259398.

HPLC - Recombinant human EGF protein (Active) (AB259398)
  • HPLC

Supplier Data

HPLC - Recombinant human EGF protein (Active) (AB259398)

Purity : 97%

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

HPLC, SDS-PAGE, FuncS, Mass Spec, Cell Culture

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of BALB / 3T3 cells is 0.99 ng/mL corresponding to a Specific Activity of 1.01 x 106 IU/mg.

Accession

P01133

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

Sequence info

[{"sequence":"NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR","proteinLength":"Full Length","predictedMolecularWeight":"6.12 kDa","actualMolecularWeight":null,"aminoAcidEnd":1023,"aminoAcidStart":971,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01133","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Epidermal Growth Factor (EGF) also known as urogastrone is a single polypeptide that facilitates cell growth proliferation and differentiation by binding to the Epidermal Growth Factor Receptor (EGFR). The EGF protein is characterized by a relatively small molecular weight of approximately 6.4 kDa. It is expressed in various tissues including the kidney submandibular glands and Brunner's glands in the mouse and other species. The presence of anti-EGF antibodies can further enhance the understanding of its mechanical actions and functions in different organisms.
Biological function summary

The epidermal growth factor plays a pivotal role in the regulation of cell signaling. It functions outside a complex interacting mainly with EGFR located on the cell surface. Upon ligand binding EGF induces the receptor dimerization leading to autophosphorylation which activates intrinsic intracellular signaling cascades. This activation is critical for cellular responses such as DNA synthesis and the progression of the cell cycle. EGF recombinant proteins such as HEGF are utilized in laboratories to examine its biological activity meticulously.

Pathways

EGF engages in key cellular pathways that mediate various essential functions. It significantly activates the MAPK and PI3K-AKT signaling pathways which govern processes such as cell division and survival. These pathways require the participation of several other proteins including Ras Raf and PDK1 which help modulate their downstream effects. The interplay of EGF with associated proteins highlights its importance in maintaining proper signaling dynamics necessary for healthy cellular function. EGF ELISA kits as well as EGF ELISAs are tools developed for robust analysis of its pathway interactions in research and clinical settings.

Altered EGF signaling is associated with increased risk of certain cancers and inflammatory diseases. Overexpression or mutations in the EGF-EGFR axis can lead to the progression of carcinomas such as those found in the lung and breast as well as disorders like psoriasis. These aberrant signaling events are often linked with other proteins such as HER2 and VEGF which can exacerbate disease severity. The study and detection of EGF products therefore offer significant insights into both the progression and potential therapeutic targeting of these conditions.

Specifications

Form

Lyophilized

Additional notes

>= 95 % HPLC.

General info

Function

EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed : 10964941).

Post-translational modifications

O-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor).

Product protocols

Target data

EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed : 10964941).
See full target information EGF

Publications (4)

Recent publications for all applications. Explore the full list and refine your search

Cells 14: PubMed40072065

2025

Systematic Comparison of FBS and Medium Variation Effect on Key Cellular Processes Using Morphological Profiling.

Applications

Unspecified application

Species

Unspecified reactive species

Timofey Lebedev,Alesya Mikheeva,Valentina Gasca,Pavel Spirin,Vladimir Prassolov

Nature communications 14:5253 PubMed37644036

2023

Loss of LCMT1 and biased protein phosphatase 2A heterotrimerization drive prostate cancer progression and therapy resistance.

Applications

Unspecified application

Species

Unspecified reactive species

Reyaz Ur Rasool,Caitlin M O'Connor,Chandan Kanta Das,Mohammed Alhusayan,Brijesh Kumar Verma,Sehbanul Islam,Ingrid E Frohner,Qu Deng,Erick Mitchell-Velasquez,Jaya Sangodkar,Aqila Ahmed,Sarah Linauer,Ingrid Mudrak,Jessica Rainey,Kaitlin P Zawacki,Tahra K Suhan,Catherine G Callahan,Ryan Rebernick,Ramakrishnan Natesan,Javed Siddiqui,Guido Sauter,Dafydd Thomas,Shaomeng Wang,Derek J Taylor,Ronald Simon,Marcin Cieslik,Arul M Chinnaiyan,Luca Busino,Egon Ogris,Goutham Narla,Irfan A Asangani

American journal of respiratory cell and molecular biology 68:577-590 PubMed36749583

2023

AKT Phosphorylates FAM13A and Promotes Its Degradation via CUL4A/DDB1/DCAF1 E3 Complex.

Applications

Unspecified application

Species

Unspecified reactive species

Lu Gong,Samuel Bates,Yujun Li,Xin Lin,Wenyi Wei,Xiaobo Zhou

Tropical biomedicine 39:36-46 PubMed35225298

2022

Potentiality of curcumin on ISHAK scoring system and the expressions of BAX, IL-17A, and EGF in the treatment ofSchistosoma mansoni infection using Swiss albino mice.

Applications

Unspecified application

Species

Unspecified reactive species

E A El Saftawy,M A El-Dardiry,A A Abd-Elaal,M S I Negm,N M Amin
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com