JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB185397

Recombinant Human Egr1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Egr1 protein is a Human Fragment protein, in the 282 to 433 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

KROX24, ZNF225, EGR1, Early growth response protein 1, EGR-1, AT225, Nerve growth factor-induced protein A, Transcription factor ETR103, Transcription factor Zif268, Zinc finger protein 225, Zinc finger protein Krox-24, NGFI-A

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

HPLC, SDS-PAGE

applications

Biologically active

No

Accession

P18146

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. Please aliquot the reconstituted solution

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS","proteinLength":"Fragment","predictedMolecularWeight":"19.91 kDa","actualMolecularWeight":null,"aminoAcidEnd":433,"aminoAcidStart":282,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P18146","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle|Reconstitute for long term storage
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Egr1 also known as early growth response protein 1 is a zinc-finger transcription factor with a molecular weight of approximately 60 kDa. The Egr1 protein plays a significant role in gene expression regulation by binding to specific DNA sequences. This target is highly expressed in a variety of tissues including the brain heart and kidneys. In these tissues Egr1 regulates several cellular processes by activating or repressing target genes. Also Egr1 has monoclonal antibodies available for research purposes providing tools for detailed study in specific cellular contexts.
Biological function summary

Egr1 acts as an immediate-early response gene. It gets rapidly upregulated in response to growth factors stress signals and other extracellular stimuli. As part of the cellular signaling networks Egr1 interacts with other transcription factors to control the expression of genes involved in cell differentiation proliferation and apoptosis. It does not typically form part of a protein complex but may work in concert with other signaling molecules to influence diverse cellular pathways and maintain cellular homeostasis.

Pathways

Egr1 is involved in the MAPK/ERK and PI3K/AKT signaling pathways both key to regulating cellular growth and survival. It functions as a bridging factor that links extracellular signals to transcriptional changes within the nucleus. In the MAPK/ERK pathway Egr1 works alongside proteins like Ras and MEK to promote early gene transcription in response to mitogenic signals. In the PI3K/AKT pathway Egr1 can influence downstream targets reinforcing the pathway's mechanisms in determining cell fate.

Egr1 is linked to cancer and cardiovascular diseases. Abnormal Egr1 expression and activity have been observed in various cancers where it can act as an oncogene or tumor suppressor depending on the context. Abnormal interactions with proteins such as p53 may contribute to tumorigenesis. In cardiovascular diseases Egr1 influences pathological states by regulating genes associated with inflammation and vascular remodeling. The protein’s dysregulation plays a part in atherosclerosis connecting with inflammatory cytokines to promote disease progression.

Specifications

Form

Lyophilized

Additional notes

Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

General info

Function

Transcriptional regulator (PubMed : 20121949). Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes (By similarity). Binds double-stranded target DNA, irrespective of the cytosine methylation status (PubMed : 25258363, PubMed : 25999311). Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death. Activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation. Required for normal progress through mitosis and normal proliferation of hepatocytes after partial hepatectomy. Mediates responses to ischemia and hypoxia; regulates the expression of proteins such as IL1B and CXCL2 that are involved in inflammatory processes and development of tissue damage after ischemia. Regulates biosynthesis of luteinizing hormone (LHB) in the pituitary (By similarity). Regulates the amplitude of the expression rhythms of clock genes : BMAL1, PER2 and NR1D1 in the liver via the activation of PER1 (clock repressor) transcription. Regulates the rhythmic expression of core-clock gene BMAL1 in the suprachiasmatic nucleus (SCN) (By similarity).

Sequence similarities

Belongs to the EGR C2H2-type zinc-finger protein family.

Subcellular localisation

Nucleus

Product protocols

Target data

Transcriptional regulator (PubMed : 20121949). Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes (By similarity). Binds double-stranded target DNA, irrespective of the cytosine methylation status (PubMed : 25258363, PubMed : 25999311). Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death. Activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation. Required for normal progress through mitosis and normal proliferation of hepatocytes after partial hepatectomy. Mediates responses to ischemia and hypoxia; regulates the expression of proteins such as IL1B and CXCL2 that are involved in inflammatory processes and development of tissue damage after ischemia. Regulates biosynthesis of luteinizing hormone (LHB) in the pituitary (By similarity). Regulates the amplitude of the expression rhythms of clock genes : BMAL1, PER2 and NR1D1 in the liver via the activation of PER1 (clock repressor) transcription. Regulates the rhythmic expression of core-clock gene BMAL1 in the suprachiasmatic nucleus (SCN) (By similarity).
See full target information EGR1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com