JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB101058

Recombinant Human EIF1AX protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human EIF1AX protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 144 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

EIF1A, EIF4C, EIF1AX, eIF-1A X isoform, eIF1A X isoform, Eukaryotic translation initiation factor 4C, eIF-4C

1 Images
SDS-PAGE - Recombinant Human EIF1AX protein (His tag N-Terminus) (AB101058)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human EIF1AX protein (His tag N-Terminus) (AB101058)

15% SDS-PAGE showing ab101058 (3 μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P47813

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI","proteinLength":"Full Length","predictedMolecularWeight":"18.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":144,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P47813","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EIF1AX also known as Eukaryotic Translation Initiation Factor 1A is essential in the initiation phase of eukaryotic translation. With a molecular mass of approximately 17 kDa EIF1AX helps in scanning the mRNA for the start codon by stabilizing the initiation complex. This protein is ubiquitously expressed playing a conserved role across various tissues. EIF1AX facilitates accurate and efficient translation initiation reinforcing its importance in cellular function.
Biological function summary

EIF1AX contributes significantly to mRNA translation by forming part of the pre-initiation complex engaging with ribosomal subunits to ensure precise codon recognition. This protein functions as a facilitator aiding the separation of ribosomal subunits which is necessary for scanning and start codon recognition. It cooperates with other initiation factors contributing to the fidelity and efficiency of protein synthesis in the cell supporting overall growth and cellular responses.

Pathways

EIF1AX integrates into the translation initiation pathway an essential step in the gene expression process. It forms associations with other initiation factors such as EIF2 and EIF5 underlining its interaction within the larger context of eukaryotic translation. EIF1AX plays a role in the MAPK signaling pathway influencing cellular processes including growth proliferation and stress response. Its involvement highlights its cross-connection with critical cellular functions through pathway integration.

EIF1AX mutations are linked to uveal melanoma and thyroid cancer. These mutations often result in altered protein activity contributing to the pathogenesis of these cancers. Additionally EIF1AX interacts with proteins like GNAQ in uveal melanoma emphasizing genetic variations can drive oncogenesis. Studying EIF1AX provides insights into tumor development and offers a potential target for therapeutic interventions in these cancers.

Specifications

Form

Liquid

Additional notes

ab101058 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon (PubMed : 9732867). This protein enhances formation of the cap-proximal complex (PubMed : 9732867). Together with EIF1, facilitates scanning, start codon recognition, promotion of the assembly of 48S complex at the initiation codon (43S PIC becomes 48S PIC after the start codon is reached), and dissociation of aberrant complexes (PubMed : 9732867). After start codon location, together with EIF5B orients the initiator methionine-tRNA in a conformation that allows 60S ribosomal subunit joining to form the 80S initiation complex (PubMed : 35732735). Is released after 80S initiation complex formation, just after GTP hydrolysis by EIF5B, and before release of EIF5B (PubMed : 35732735). Its globular part is located in the A site of the 40S ribosomal subunit (PubMed : 35732735). Its interaction with EIF5 during scanning contribute to the maintenance of EIF1 within the open 43S PIC (PubMed : 24319994). In contrast to yeast orthologs, does not bind EIF1 (PubMed : 24319994).

Sequence similarities

Belongs to the eIF-1A family.

Product protocols

Target data

Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon (PubMed : 9732867). This protein enhances formation of the cap-proximal complex (PubMed : 9732867). Together with EIF1, facilitates scanning, start codon recognition, promotion of the assembly of 48S complex at the initiation codon (43S PIC becomes 48S PIC after the start codon is reached), and dissociation of aberrant complexes (PubMed : 9732867). After start codon location, together with EIF5B orients the initiator methionine-tRNA in a conformation that allows 60S ribosomal subunit joining to form the 80S initiation complex (PubMed : 35732735). Is released after 80S initiation complex formation, just after GTP hydrolysis by EIF5B, and before release of EIF5B (PubMed : 35732735). Its globular part is located in the A site of the 40S ribosomal subunit (PubMed : 35732735). Its interaction with EIF5 during scanning contribute to the maintenance of EIF1 within the open 43S PIC (PubMed : 24319994). In contrast to yeast orthologs, does not bind EIF1 (PubMed : 24319994).
See full target information EIF1AX

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Science advances 10:eadq6342 PubMed39565848

2024

Hepatovirus translation requires PDGFA-associated protein 1, an eIF4E-binding protein regulating endoplasmic reticulum stress responses.

Applications

Unspecified application

Species

Unspecified reactive species

Takayoshi Shirasaki,Erik Lenarcic,Ichiro Misumi,Ling Xie,William G Fusco,Bryan Yonish,Anshuman Das,Hyejeong Kim,Craig E Cameron,Mélissa Léger-Abraham,Xian Chen,John M Cullen,Jason K Whitmire,You Li,Joseph A Duncan,Nathaniel J Moorman,Stanley M Lemon
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com