JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB103788

Recombinant Human EIF1AY protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human EIF1AY protein is a Human Full Length protein, in the 1 to 144 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

eIF-1A Y isoform, eIF1A Y isoform, Eukaryotic translation initiation factor 4C, eIF-4C, EIF1AY

1 Images
SDS-PAGE - Recombinant Human EIF1AY protein (AB103788)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human EIF1AY protein (AB103788)

15% SDS-PAGE analysis of 3μg ab103788.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

O14602

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI","proteinLength":"Full Length","predictedMolecularWeight":"18.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":144,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O14602","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EIF1AY also known as eukaryotic translation initiation factor 1A Y-linked is a protein that plays a critical role in the initiation of protein synthesis. It has a molecular mass of about 17 kDa and is expressed specifically on the Y chromosome making it uniquely present in males. EIF1AY is part of the translation initiation complex where it facilitates the recruitment and correct positioning of the ribosome on mRNA a step essential for the formation of the pre-initiation complex in protein synthesis.
Biological function summary

EIF1AY contributes to cellular translation processes by forming a complex with other translation initiation factors. This complex stabilizes the mRNA binding and enables the scanning process for the start codon which is an important step in initiating translation. Through these interactions EIF1AY ensures the fidelity and efficiency of protein synthesis which is fundamental for cell growth and proliferation.

Pathways

EIF1AY is involved in the mTOR signaling pathway which regulates growth and metabolism in response to environmental cues. This pathway involves other important translation initiation factors including eIF4E and eIF4G which work together to control protein synthesis in response to nutrients and growth factors. EIF1AY also plays a role in the integrated stress response pathway which adjusts protein synthesis rates during cellular stress conditions by modulating eukaryotic initiation factors.

Disruptions in EIF1AY function are linked to certain male-specific conditions given its Y-linked expression. This includes infertility issues attributable to defects in spermatogenesis where EIF1AY’s role in protein synthesis is critical. EIF1AY may also relate to disorders involving aberrant protein synthesis in connection with proteins like eIF2 which regulates the initiation phase under stress conditions. Understanding these connections can provide insights into targeted treatments for affected conditions.

Specifications

Form

Liquid

Additional notes

ab103788 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon. This protein enhances formation of the cap-proximal complex. Together with EIF1, facilitates scanning, start codon recognition, promotion of the assembly of 48S complex at the initiation codon (43S PIC becomes 48S PIC after the start codon is reached), and dissociation of aberrant complexes. After start codon location, together with EIF5B orients the initiator methionine-tRNA in a conformation that allows 60S ribosomal subunit joining to form the 80S initiation complex. Is released after 80S initiation complex formation, just after GTP hydrolysis by EIF5B, and before release of EIF5B. Its globular part is located in the A site of the 40S ribosomal subunit. Its interaction with EIF5 during scanning contribute to the maintenance of EIF1 within the open 43S PIC. In contrast to yeast orthologs, does not bind EIF1.

Sequence similarities

Belongs to the eIF-1A family.

Product protocols

Target data

Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon. This protein enhances formation of the cap-proximal complex. Together with EIF1, facilitates scanning, start codon recognition, promotion of the assembly of 48S complex at the initiation codon (43S PIC becomes 48S PIC after the start codon is reached), and dissociation of aberrant complexes. After start codon location, together with EIF5B orients the initiator methionine-tRNA in a conformation that allows 60S ribosomal subunit joining to form the 80S initiation complex. Is released after 80S initiation complex formation, just after GTP hydrolysis by EIF5B, and before release of EIF5B. Its globular part is located in the A site of the 40S ribosomal subunit. Its interaction with EIF5 during scanning contribute to the maintenance of EIF1 within the open 43S PIC. In contrast to yeast orthologs, does not bind EIF1.
See full target information EIF1AY

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com