JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB171467

Recombinant Human EIF3F protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human EIF3F protein (denatured) (His tag N-Terminus) is a Human Full Length protein, in the 1 to 357 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

EIF3S5, EIF3F, Eukaryotic translation initiation factor 3 subunit F, eIF3f, Deubiquitinating enzyme eIF3f, Eukaryotic translation initiation factor 3 subunit 5, eIF-3-epsilon, eIF3 p47

1 Images
SDS-PAGE - Recombinant Human EIF3F protein (denatured) (His tag N-Terminus) (AB171467)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human EIF3F protein (denatured) (His tag N-Terminus) (AB171467)

15% SDS-PAGE analysis of ab171467 (3µg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O00303

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL","proteinLength":"Full Length","predictedMolecularWeight":"40 kDa","actualMolecularWeight":null,"aminoAcidEnd":357,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O00303","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EIF3F also known as eukaryotic translation initiation factor 3 subunit F is a critical component in the initiation of mRNA translation. The molecular weight of EIF3F is approximately 42 kDa. This protein is expressed in various tissues with a higher presence in rapidly dividing cells such as those in the liver and testes. EIF3F plays a mechanical role in the recruitment and assembly of other initiation factors and ribosomal units facilitating the proper positioning of the mRNA on the ribosome.
Biological function summary

EIF3F contributes to the regulation of protein synthesis by being part of the EIF3 complex which is essential for translation initiation. This complex interacts with several other initiation factors to ensure efficient ribosomal translation of mRNA into proteins. EIF3F is involved in maintaining the balance between global protein synthesis and selective translation thereby influencing cell growth and proliferation. Its interaction with ribosomal RNA and other initiation factors helps in stabilizing the pre-initiation complex.

Pathways

EIF3F is integral to the mTOR signaling pathway and the endoplasmic reticulum (ER) stress response pathway. These pathways are central to cellular responses to nutrient availability and misfolded proteins respectively. The mTOR pathway involves EIF3F in regulating cell growth and autophagy through its interaction with other proteins like TSC1/2. In the ER stress response EIF3F works alongside proteins such as ATF4 to control protein synthesis rates during stress conditions.

EIF3F shows associations with cancer and neurodegenerative diseases. In cancer aberrant EIF3F expression can lead to uncontrolled cell growth and tumor formation particularly noted in liver and prostate cancers. It interacts frequently with proteins like c-Myc which are key in oncogenic pathways. In neurodegenerative conditions disruptions in EIF3F and related proteins can affect neural cell survival with links observed in disorders such as amyotrophic lateral sclerosis (ALS). The disruption in EIF3F's role in protein synthesis pathways may contribute to neuronal damage and disease progression.

Specifications

Form

Liquid

General info

Function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed : 17581632, PubMed : 25849773, PubMed : 27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2 : GTP : methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed : 17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed : 25849773).. Deubiquitinates activated NOTCH1, promoting its nuclear import, thereby acting as a positive regulator of Notch signaling.

Sequence similarities

Belongs to the eIF-3 subunit F family.

Post-translational modifications

Phosphorylation is enhanced upon serum stimulation. Phosphorylated during apoptosis by caspase-processed CDK11.

Product protocols

Target data

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed : 17581632, PubMed : 25849773, PubMed : 27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2 : GTP : methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed : 17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed : 25849773).. Deubiquitinates activated NOTCH1, promoting its nuclear import, thereby acting as a positive regulator of Notch signaling.
See full target information EIF3F

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com