JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB104639

Recombinant Human eIF3K protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human eIF3K protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 218 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

EIF3S12, ARG134, HSPC029, MSTP001, PTD001, EIF3K, Eukaryotic translation initiation factor 3 subunit K, eIF3k, Eukaryotic translation initiation factor 3 subunit 12, Muscle-specific gene M9 protein, PLAC-24, eIF-3 p25, eIF-3 p28

1 Images
SDS-PAGE - Recombinant Human eIF3K protein (His tag N-Terminus) (AB104639)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human eIF3K protein (His tag N-Terminus) (AB104639)

15% SDS-PAGE analysis of 3μg ab104639.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q9UBQ5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ","proteinLength":"Full Length","predictedMolecularWeight":"27.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":218,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UBQ5","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EIF3K also known as eukaryotic translation initiation factor 3 subunit K is a protein subunit of the eIF3 complex. This protein has a mass of approximately 30 kilodaltons and it is expressed in many tissues across the body. The mechanical role of eIF3K is primarily in the assembly and functioning of the translation initiation complex which positions ribosomes at the start codon of messenger RNA (mRNA) strands to begin protein synthesis.
Biological function summary

EIF3K is involved in the regulation of the eukaryotic translation initiation factor 3 complex which is essential for initiating translation by serving as a scaffold for other eIF3 subunits. This complex stabilizes the formation of the pre-initiation complex necessary for ribosome binding to mRNA. Through its involvement in protein synthesis eIF3K influences cell growth proliferation and response to various cellular signals. It is involved in processes such as cell cycle control and apoptotic regulation as it aids the translation of specific mRNAs coding for key regulatory proteins.

Pathways

EIF3K participates in mTOR and Wnt signaling pathways. These pathways are critical in controlling cell growth proliferation and differentiation. Through mTOR signaling eIF3K interacts with proteins like ribosomal protein S6 kinase beta-1 (S6K1) influencing cell metabolism and growth. In the Wnt pathway eIF3K contributes to the translation of proteins that regulate cell fate and stem cell renewal. Interactions with these pathways illustrate the importance of eIF3K in maintaining cellular homeostasis.

Alterations in eIF3K function have links to cancer and neurodegenerative diseases. In cancer dysregulated eIF3K expression can lead to unregulated cell growth and tumorigenesis due to its role in protein synthesis and cell proliferation. eIF3K connects to oncogenic proteins such as c-Myc which stimulate cancer progression. In neurodegenerative diseases eIF3K may contribute to cell death through its interactions with apoptotic pathways and impaired cellular stress responses highlighting its potential as a target for therapeutic intervention.

Specifications

Form

Liquid

Additional notes

ab104639 is purified using conventional chromatography techniques.

General info

Function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed : 17581632, PubMed : 25849773, PubMed : 27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2 : GTP : methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed : 17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed : 25849773).

Sequence similarities

Belongs to the eIF-3 subunit K family.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed : 17581632, PubMed : 25849773, PubMed : 27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2 : GTP : methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed : 17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed : 25849773).
See full target information EIF3K

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com