JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113578

Recombinant Human EIF3S1/EIF3J protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human EIF3S1/EIF3J protein is a Human Fragment protein, in the 70 to 258 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

EIF3S1, PRO0391, EIF3J, Eukaryotic translation initiation factor 3 subunit J, eIF3j, Eukaryotic translation initiation factor 3 subunit 1, eIF-3-alpha, eIF3 p35

1 Images
SDS-PAGE - Recombinant Human EIF3S1/EIF3J protein (AB113578)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human EIF3S1/EIF3J protein (AB113578)

ab113578 at 3 μg analysed by SDS PAGE.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

O75822

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as EIF3S1

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM","proteinLength":"Fragment","predictedMolecularWeight":"24 kDa","actualMolecularWeight":null,"aminoAcidEnd":258,"aminoAcidStart":70,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O75822","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EIF3S1 also known as EIF3J is a subunit of the eukaryotic initiation factor 3 (eIF3) complex. It has a molecular mass of approximately 29 kDa. This protein is integral to the assembly of the eIF3 complex which plays an important role in the initiation phase of translation. EIF3J is expressed in various tissues including those with high rates of protein synthesis such as muscle and liver.
Biological function summary

The eIF3J protein functions as part of the eIF3 complex to facilitate the formation of the 43S pre-initiation complex. It assists in stabilizing the interaction between the small ribosomal subunit and mRNA enhancing the accuracy and efficiency of translation initiation. The eIF3 complex is composed of 13 subunits and EIF3J contributes to the structural integrity and functionality of this complex making it essential for proper translation initiation.

Pathways

EIF3J participates in the mTOR signaling pathway and the MAPK signaling pathway. These pathways regulate cell growth proliferation and survival. In the mTOR pathway the eIF3 complex including EIF3J associates with proteins like mTORC1 to influence protein synthesis and cell growth. In the MAPK pathway EIF3J helps control translation in response to extracellular stimuli through its involvement in the eIF3 complex.

EIF3J is linked to cancer and neurodegenerative diseases. Altered expression or dysfunction of the eIF3 complex involving EIF3J can lead to unregulated protein synthesis contributing to tumorigenesis. Additionally anomalies in translation can impact proteins associated with neurodegenerative conditions like Alzheimer's disease where improper protein synthesis regulation can exacerbate disease progression.

Specifications

Form

Liquid

Additional notes

ab113578 is purified using conventional chromatography techniques.

General info

Function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed : 25849773, PubMed : 27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2 : GTP : methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed : 25849773).

Sequence similarities

Belongs to the eIF-3 subunit J family.

Post-translational modifications

Phosphorylated. Phosphorylation is enhanced upon serum stimulation.

Product protocols

Target data

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed : 25849773, PubMed : 27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2 : GTP : methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed : 25849773).
See full target information EIF3J

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com