JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB99140

Recombinant Human eIF5A2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human eIF5A2 protein is a Human Full Length protein, in the 1 to 153 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Eukaryotic translation initiation factor 5A-2, eIF-5A-2, eIF-5A2, Eukaryotic initiation factor 5A isoform 2, EIF5A2

7 Images
Western blot - Recombinant Human eIF5A2 protein (AB99140)
  • WB

Lab

Western blot - Recombinant Human eIF5A2 protein (AB99140)

**Blocking buffer : ** 5% NFDM/TBST This data was developed using ab126735, the same antibody clone in a different buffer formulation.

All lanes:

Western blot - Anti-eIF5A2 + eIF5A antibody [EPR7411-6] (<a href='/en-us/products/primary-antibodies/eif5a2-eif5a-antibody-epr7411-6-ab126735'>ab126735</a>) at 1/2000 dilution

Lane 1:

Western blot - Recombinant Human eIF5A protein (<a href='/en-us/products/proteins-peptides/recombinant-human-eif5a-protein-ab87457'>ab87457</a>) at 0.01 µg

Lane 2:

Western blot - Recombinant Human eIF5A2 protein (ab99140) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 17 kDa

Observed band size: 15 kDa,20 kDa

false

Exposure time: 20s

Western blot - Recombinant Human eIF5A2 protein (AB99140)
  • WB

Supplier Data

Western blot - Recombinant Human eIF5A2 protein (AB99140)

**Blocking buffer : ** 5% NFDM/TBST This data was developed using ab32407, the same antibody clone in a different buffer formulation.

All lanes:

Western blot - Anti-eIF5A antibody [EP527Y] (<a href='/en-us/products/primary-antibodies/eif5a-antibody-ep527y-ab32407'>ab32407</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human eIF5A protein (<a href='/en-us/products/proteins-peptides/recombinant-human-eif5a-protein-ab87457'>ab87457</a>) at 0.01 µg

Lane 2:

Western blot - Recombinant Human eIF5A2 protein (ab99140) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 16 kDa

Observed band size: 16 kDa

true

Exposure time: 20s

Western blot - Recombinant Human eIF5A2 protein (AB99140)
  • WB

Lab

Western blot - Recombinant Human eIF5A2 protein (AB99140)

**Blocking buffer : ** 5% NFDM/TBST This data was developed using ab150403, the same antibody clone in a different buffer formulation.

All lanes:

Western blot - Anti-eIF5A2 + eIF5A antibody [EPR7411-105] (<a href='/en-us/products/primary-antibodies/eif5a2-eif5a-antibody-epr7411-105-ab150403'>ab150403</a>) at 1/2000 dilution

Lane 1:

Western blot - Recombinant Human eIF5A protein (<a href='/en-us/products/proteins-peptides/recombinant-human-eif5a-protein-ab87457'>ab87457</a>) at 0.01 µg

Lane 2:

Western blot - Recombinant Human eIF5A2 protein (ab99140) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 17 kDa

Observed band size: 15 kDa,20 kDa

true

Exposure time: 20s

Western blot - Recombinant Human eIF5A2 protein (AB99140)
  • WB

Lab

Western blot - Recombinant Human eIF5A2 protein (AB99140)

**Blocking buffer : ** 5% NFDM/TBST This data was developed using ab150439, the same antibody clone in a different buffer formulation.

All lanes:

Western blot - Anti-eIF5A2 + eIF5A antibody [EPR7412-50] (<a href='/en-us/products/primary-antibodies/eif5a2-eif5a-antibody-epr7412-50-ab150439'>ab150439</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human eIF5A protein (<a href='/en-us/products/proteins-peptides/recombinant-human-eif5a-protein-ab87457'>ab87457</a>) at 0.01 µg

Lane 2:

Western blot - Recombinant Human eIF5A2 protein (ab99140) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 17 kDa

Observed band size: 15 kDa,20 kDa

true

Exposure time: 7s

Western blot - Recombinant Human eIF5A2 protein (AB99140)
  • WB

Lab

Western blot - Recombinant Human eIF5A2 protein (AB99140)

This data was developed using ab32443, the same antibody clone in a different buffer formulation. **Blocking buffer : ** 5% NFDM/TBST This antibody shows low affinity in recognizing eIF5A2 recombinant protein.

All lanes:

Western blot - Anti-eIF5A antibody [EP526Y] (<a href='/en-us/products/primary-antibodies/eif5a-antibody-ep526y-ab32443'>ab32443</a>) at 1/2000 dilution

Lane 1:

Western blot - Recombinant Human eIF5A protein (<a href='/en-us/products/proteins-peptides/recombinant-human-eif5a-protein-ab87457'>ab87457</a>) at 0.01 µg

Lane 2:

Western blot - Recombinant Human eIF5A2 protein (ab99140) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 16 kDa

Observed band size: 15 kDa,20 kDa

true

Exposure time: 20s

Western blot - Recombinant Human eIF5A2 protein (AB99140)
  • WB

Lab

Western blot - Recombinant Human eIF5A2 protein (AB99140)

**Blocking buffer : ** 5% NFDM/TBST This data was developed using ab126733, the same antibody clone in a different buffer formulation.

All lanes:

Western blot - Anti-eIF5A2 + eIF5A antibody [EPR7412-47] (<a href='/en-us/products/primary-antibodies/eif5a2-eif5a-antibody-epr7412-47-ab126733'>ab126733</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human eIF5A protein (<a href='/en-us/products/proteins-peptides/recombinant-human-eif5a-protein-ab87457'>ab87457</a>) at 0.01 µg

Lane 2:

Western blot - Recombinant Human eIF5A2 protein (ab99140) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 17 kDa

Observed band size: 15 kDa,20 kDa

true

Exposure time: 3min

SDS-PAGE - Recombinant Human eIF5A2 protein (AB99140)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human eIF5A2 protein (AB99140)

15% SDS-PAGE analysis of 3μg ab99140

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9GZV4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK","proteinLength":"Full Length","predictedMolecularWeight":"18.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":153,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9GZV4","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EIF5A2 also known as eukaryotic translation initiation factor 5A isoform 2 is a small protein about 17 kDa in mass. It is involved in translation elongation and facilitates the assembly of ribosomes on mRNA during protein synthesis. The protein is ubiquitously expressed in many tissues with high levels of expression in cancer cells compared to normal tissues. eIF5A2 possesses a unique post-translational modification hypusination which is important for its function.
Biological function summary

EIF5A2 promotes the synthesis of proteins essential for cell proliferation and survival. It does this by binding to mRNAs and enhancing the translation of specific genes that are often implicated in cancer development. eIF5A2 is not part of a larger protein complex but works in conjunction with ribosomal units during the translation process. Its hypusinated form is responsible for the specific and efficient translation process that influences cellular growth and apoptosis.

Pathways

EIF5A2 functions as a significant player in the pathways related to translation and cell cycle regulation. Specifically it interacts within the mTOR and Wnt signaling pathways. These pathways are associated with cell growth and cancer involving proteins like mTOR and β-catenin respectively which are vital for regulating processes such as cell growth proliferation and differentiation.

EIF5A2 has strong relevance to cancer particularly in its overexpression linked to tumor progression and metastasis in various cancers such as colorectal and ovarian cancer. In these cancers the expression of eIF5A2 often correlates with poor prognosis. It is associated with proteins like matrix metalloproteinases (MMPs) which play a role in cancer cell invasion and metastasis. Moreover abnormalities in eIF5A2 expression or activity might also relate to neurodegenerative disorders providing a potential target for treatment strategies in these diseases.

Specifications

Form

Liquid

Additional notes

ab99140 was purified using conventional chromatography.

General info

Function

Translation factor that promotes translation elongation and termination, particularly upon ribosome stalling at specific amino acid sequence contexts (PubMed : 14622290). Binds between the exit (E) and peptidyl (P) site of the ribosome and promotes rescue of stalled ribosome : specifically required for efficient translation of polyproline-containing peptides as well as other motifs that stall the ribosome. Acts as a ribosome quality control (RQC) cofactor by joining the RQC complex to facilitate peptidyl transfer during CAT tailing step (By similarity). Also involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity (By similarity).

Sequence similarities

Belongs to the eIF-5A family.

Post-translational modifications

Lys-50 undergoes hypusination, a unique post-translational modification that consists in the addition of a butylamino group from spermidine to lysine side chain and leads to the formation of a hypusine residue. eIF-5As are the only known proteins to undergo this modification, which is essential for their function.

Subcellular localisation

Nucleus

Product protocols

Target data

Translation factor that promotes translation elongation and termination, particularly upon ribosome stalling at specific amino acid sequence contexts (PubMed : 14622290). Binds between the exit (E) and peptidyl (P) site of the ribosome and promotes rescue of stalled ribosome : specifically required for efficient translation of polyproline-containing peptides as well as other motifs that stall the ribosome. Acts as a ribosome quality control (RQC) cofactor by joining the RQC complex to facilitate peptidyl transfer during CAT tailing step (By similarity). Also involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity (By similarity).
See full target information Eukaryotic translation initiation factor 5A-2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com