JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271497

Recombinant human Elongin-B + Elongin C + VHL protein (Tagged)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human Elongin-B + Elongin C + VHL protein (Tagged) is a Human Full Length protein, in the 2 to 212 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE, FuncS.

View Alternative Names

TCEB2, ELOB, Elongin-B, EloB, Elongin 18 kDa subunit, RNA polymerase II transcription factor SIII subunit B, SIII p18, Transcription elongation factor B polypeptide 2

2 Images
Functional Studies - Recombinant human Elongin-B + Elongin C + VHL protein (Tagged) (AB271497)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Elongin-B + Elongin C + VHL protein (Tagged) (AB271497)

ab271497-BRD3 interaction.

SDS-PAGE - Recombinant human Elongin-B + Elongin C + VHL protein (Tagged) (AB271497)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Elongin-B + Elongin C + VHL protein (Tagged) (AB271497)

SDS-PAGE analysis of ab271497.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Assay Conditions: Various amounts of ab271497 were incubated in 10-ul reaction with ARV-771 and GST-BRD3(BD2) at room temperature for one hour. After this, FLAG-acceptor beads and GSH-donor beads were added followed by detection of A-counts.

Accession

Q15370

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"PRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD","proteinLength":"Full Length","predictedMolecularWeight":"25 kDa","actualMolecularWeight":null,"aminoAcidEnd":212,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P40337","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]},{"sequence":"DVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ","proteinLength":"Full Length","predictedMolecularWeight":"14 kDa","actualMolecularWeight":null,"aminoAcidEnd":118,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q15370","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]},{"sequence":"DGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC","proteinLength":"Full Length","predictedMolecularWeight":"13 kDa","actualMolecularWeight":null,"aminoAcidEnd":112,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q15369","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Liquid

General info

Function

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed : 7638163). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).. Core component of multiple cullin-2 and cullin-5-RING E3 ubiquitin-protein ligase complexes (ECS complexes), which mediate the ubiquitination of target proteins (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694, PubMed : 26138980, PubMed : 29775578, PubMed : 29779948, PubMed : 33268465, PubMed : 38326650). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). Component the von Hippel-Lindau ubiquitination complex CBC(VHL) (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). A number of ECS complexes (containing either KLHDC2, KLHDC3, KLHDC10, APPBP2, FEM1A, FEM1B or FEM1C as substrate-recognition component) are part of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation (PubMed : 26138980, PubMed : 29775578, PubMed : 29779948). The ECS(ASB9) complex mediates ubiquitination and degradation of CKB (PubMed : 33268465). As part of a multisubunit ubiquitin ligase complex, polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177). ECS(LRR1) ubiquitinates MCM7 and promotes CMG replisome disassembly by VCP and chromatin extraction during S-phase (By similarity).. (Microbial infection) Following infection by HIV-1 virus, component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex) hijacked by the HIV-1 Vif protein, which catalyzes ubiquitination and degradation of APOBEC3F and APOBEC3G (PubMed : 18562529, PubMed : 20532212, PubMed : 22190037, PubMed : 24225024, PubMed : 24402281, PubMed : 36754086). The complex can also ubiquitinate APOBEC3H to some extent (PubMed : 37640699).

Subcellular localisation

Nucleus

Product protocols

Target data

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed : 7638163). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).. Core component of multiple cullin-2 and cullin-5-RING E3 ubiquitin-protein ligase complexes (ECS complexes), which mediate the ubiquitination of target proteins (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694, PubMed : 26138980, PubMed : 29775578, PubMed : 29779948, PubMed : 33268465, PubMed : 38326650). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). Component the von Hippel-Lindau ubiquitination complex CBC(VHL) (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). A number of ECS complexes (containing either KLHDC2, KLHDC3, KLHDC10, APPBP2, FEM1A, FEM1B or FEM1C as substrate-recognition component) are part of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation (PubMed : 26138980, PubMed : 29775578, PubMed : 29779948). The ECS(ASB9) complex mediates ubiquitination and degradation of CKB (PubMed : 33268465). As part of a multisubunit ubiquitin ligase complex, polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177). ECS(LRR1) ubiquitinates MCM7 and promotes CMG replisome disassembly by VCP and chromatin extraction during S-phase (By similarity).. (Microbial infection) Following infection by HIV-1 virus, component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex) hijacked by the HIV-1 Vif protein, which catalyzes ubiquitination and degradation of APOBEC3F and APOBEC3G (PubMed : 18562529, PubMed : 20532212, PubMed : 22190037, PubMed : 24225024, PubMed : 24402281, PubMed : 36754086). The complex can also ubiquitinate APOBEC3H to some extent (PubMed : 37640699).
See full target information ELOB

Additional targets

ELOC,VHL

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

PLoS pathogens 21:e1013241 PubMed40522994

2025

PHD3-VHL axis controls HIV-2 infection through oxygen-dependent hydroxylation and degradation of Vpx.

Applications

Unspecified application

Species

Unspecified reactive species

Kei Miyakawa,Kiho Tanaka,Yoko Ino,Yayoi Kimura,Taichi Kameya,Fuminori Mizukoshi,Mayuko Nishi,Masaru Yokoyama,Jun Nakabayashi,Masako Nomaguchi,Hironori Sato,Hirokazu Kimura,Hirofumi Akari,Tomoyuki Miura,Akinori Takaoka,Hideki Hasegawa,Tetsuro Matano,Yoji Andrew Minamishima,Akihide Ryo
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com