JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB116195

Recombinant Human Elongin-C protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Elongin-C protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 112 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

TCEB1, ELOC, Elongin-C, EloC, Elongin 15 kDa subunit, RNA polymerase II transcription factor SIII subunit C, SIII p15, Transcription elongation factor B polypeptide 1

1 Images
SDS-PAGE - Recombinant Human Elongin-C protein (His tag N-Terminus) (AB116195)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Elongin-C protein (His tag N-Terminus) (AB116195)

15% SDS-PAGE analysis of 3 µg ab116195.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q15369

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as TCEB1.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC","proteinLength":"Full Length","predictedMolecularWeight":"14.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":112,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q15369","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Elongin C also known as Elongin BC is a small protein with a mass of approximately 11 kDa. This protein is part of the Elongin complex which includes Elongin B and Elongin A. It is widely expressed in various tissues facilitating its role in transcriptional regulation. Elongin C works mechanically by forming a complex with Elongin B to elongate RNA polymerase II transcription and it acts as an adaptor in various cellular processes.
Biological function summary

Elongin C participates in stabilizing the association of Elongin A with RNA polymerase II. It is an essential component of the transcription elongation complex influencing the transcriptional activity of genes. By forming a complex with Elongin B it propels the transcription process forward particularly in response to signals that regulate transcription elongation. Elongin C also connects with the cullin-RING E3 ubiquitin ligase (CRL) complex contributing to protein degradation pathways.

Pathways

Elongin C plays a significant role in the ubiquitin-proteasome system which targets proteins for degradation. It functions alongside Elongin A and Elongin B in this pathway where these components coordinate to control protein levels in the cell. Elongin C associates with the VHL (Von Hippel-Lindau) tumor suppressor protein in the pathway responsible for hypoxia-inducible factor (HIF) degradation therefore influencing cellular responses to oxygen availability.

Alterations in Elongin C are implicated in cancer and von Hippel-Lindau disease. The disruption of its function can affect the stability and degradation of HIF leading to aberrant cellular proliferation and tumor progression. Elongin C through interaction with VHL highlights its importance in managing proper cell growth and differentiation underpinning its potential role in developing therapeutic targets for cancer treatment.

Specifications

Form

Liquid

Additional notes

ab116195 was purified using conventional chromatography techniques.

General info

Function

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed : 7821821). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).. Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694, PubMed : 21199876, PubMed : 26138980, PubMed : 29775578, PubMed : 29779948, PubMed : 30166453, PubMed : 33268465, PubMed : 38326650). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). Component the von Hippel-Lindau ubiquitination complex CBC(VHL) (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). A number of ECS complexes (containing either KLHDC2, KLHDC3, KLHDC10, APPBP2, FEM1A, FEM1B or FEM1C as substrate-recognition component) are part of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation (PubMed : 26138980, PubMed : 29775578, PubMed : 29779948). The ECS(ASB9) complex mediates ubiquitination and degradation of CKB (PubMed : 33268465). As part of a multisubunit ubiquitin ligase complex, polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177). ECS(LRR1) ubiquitinates MCM7 and promotes CMG replisome disassembly by VCP and chromatin extraction during S-phase (By similarity).. (Microbial infection) Following infection by HIV-1 virus, component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex) hijacked by the HIV-1 Vif protein, which catalyzes ubiquitination and degradation of APOBEC3F and APOBEC3G (PubMed : 18562529, PubMed : 20532212, PubMed : 22190037, PubMed : 24225024, PubMed : 24402281, PubMed : 36754086). The complex can also ubiquitinate APOBEC3H to some extent (PubMed : 37640699).

Sequence similarities

Belongs to the SKP1 family.

Post-translational modifications

Ubiquitinated by the DCX(AMBRA1) complex, leading to its degradation by the proteasome.

Subcellular localisation

Nucleus

Product protocols

Target data

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed : 7821821). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).. Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694, PubMed : 21199876, PubMed : 26138980, PubMed : 29775578, PubMed : 29779948, PubMed : 30166453, PubMed : 33268465, PubMed : 38326650). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). Component the von Hippel-Lindau ubiquitination complex CBC(VHL) (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). A number of ECS complexes (containing either KLHDC2, KLHDC3, KLHDC10, APPBP2, FEM1A, FEM1B or FEM1C as substrate-recognition component) are part of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation (PubMed : 26138980, PubMed : 29775578, PubMed : 29779948). The ECS(ASB9) complex mediates ubiquitination and degradation of CKB (PubMed : 33268465). As part of a multisubunit ubiquitin ligase complex, polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177). ECS(LRR1) ubiquitinates MCM7 and promotes CMG replisome disassembly by VCP and chromatin extraction during S-phase (By similarity).. (Microbial infection) Following infection by HIV-1 virus, component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex) hijacked by the HIV-1 Vif protein, which catalyzes ubiquitination and degradation of APOBEC3F and APOBEC3G (PubMed : 18562529, PubMed : 20532212, PubMed : 22190037, PubMed : 24225024, PubMed : 24402281, PubMed : 36754086). The complex can also ubiquitinate APOBEC3H to some extent (PubMed : 37640699).
See full target information ELOC

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com