JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276462

Recombinant Human EMA protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human EMA protein (Fc Chimera) is a Human Fragment protein, in the 1 to 167 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD227, PUM, MUC1, Mucin-1, MUC-1, Breast carcinoma-associated antigen DF3, Cancer antigen 15-3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin, CA 15-3, KL-6, PEM, EMA

1 Images
SDS-PAGE - Recombinant Human EMA protein (Fc Chimera) (AB276462)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human EMA protein (Fc Chimera) (AB276462)

SDS-PAGE analysis of ab276462

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P15941

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG","proteinLength":"Fragment","predictedMolecularWeight":"42 kDa","actualMolecularWeight":null,"aminoAcidEnd":167,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P15941","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EMA or epithelial membrane antigen is a well-studied glycoprotein with an approximate molecular weight of 40-60 kDa. Also known as MUC1 this protein predominantly appears on the apical surface of epithelial cells in tissues like breast lung and gastrointestinal tract. EMA exists in abundance on the epithelial cell surface especially in secretory epithelia acting as a molecular barrier between environment and underlying tissue.
Biological function summary

Epithelial membrane antigen plays a role in cell signaling and protection. It is a part of the mucin family which are high-molecular-weight glycoproteins involved in forming protective mucous barriers on epithelial surfaces. EMA has an extended structure that contributes to providing cellular adhesion through its tandem repeat domains. This protein is not typically part of larger multiprotein complexes but nonetheless influences cellular phenotype and immune responses.

Pathways

Epithelial membrane antigen is involved in several key biological processes such as cell adhesion and signal transduction. It plays a critical role in pathways associated with epithelial cell growth and differentiation. An important pathway involving MUC1 is the EGFR signaling pathway where it modulates the activity through interactions with related proteins like EGFR and c-Src. These interactions enable cells to respond to extracellular signals ultimately influencing proliferation and survival.

Epithelial membrane antigen shows a significant correlation with cancer particularly breast and ovarian cancer. Aberrant expression or glycosylation of EMA can lead to altered cell signaling and adhesion promoting tumor progression. MUC1 associates with proteins like p53 and β-catenin during oncogenic transformation which are well-known players in cancer biology. As such EMA serves as an important biomarker for cancer diagnosis and prognosis aiding in the development of therapeutic strategies.

Specifications

Form

Lyophilized

General info

Function

The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.. The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.

Post-translational modifications

Highly glycosylated (N- and O-linked carbohydrates and sialic acid). O-glycosylated to a varying degree on serine and threonine residues within each tandem repeat, ranging from mono- to penta-glycosylation. The average density ranges from about 50% in human milk to over 90% in T47D breast cancer cells. Further sialylation occurs during recycling. Membrane-shed glycoproteins from kidney and breast cancer cells have preferentially sialyated core 1 structures, while secreted forms from the same tissues display mainly core 2 structures. The O-glycosylated content is overlapping in both these tissues with terminal fucose and galactose, 2- and 3-linked galactose, 3- and 3,6-linked GalNAc-ol and 4-linked GlcNAc predominating. Differentially O-glycosylated in breast carcinomas with 3,4-linked GlcNAc. N-glycosylation consists of high-mannose, acidic complex-type and hybrid glycans in the secreted form MUC1/SEC, and neutral complex-type in the transmembrane form, MUC1/TM.. Proteolytic cleavage in the SEA domain occurs in the endoplasmic reticulum by an autoproteolytic mechanism and requires the full-length SEA domain as well as requiring a Ser, Thr or Cys residue at the P + 1 site. Cleavage at this site also occurs on isoform MUC1/X but not on isoform MUC1/Y. Ectodomain shedding is mediated by ADAM17.. Dual palmitoylation on cysteine residues in the CQC motif is required for recycling from endosomes back to the plasma membrane.. Phosphorylated on tyrosines and serine residues in the C-terminal. Phosphorylation on tyrosines in the C-terminal increases the nuclear location of MUC1 and beta-catenin. Phosphorylation by PKC delta induces binding of MUC1 to beta-catenin/CTNNB1 and thus decreases the formation of the beta-catenin/E-cadherin complex. Src-mediated phosphorylation inhibits interaction with GSK3B. Src- and EGFR-mediated phosphorylation on Tyr-1229 increases binding to beta-catenin/CTNNB1. GSK3B-mediated phosphorylation on Ser-1227 decreases this interaction but restores the formation of the beta-cadherin/E-cadherin complex. On T-cell receptor activation, phosphorylated by LCK. PDGFR-mediated phosphorylation increases nuclear colocalization of MUC1CT and CTNNB1.. The N-terminal sequence has been shown to begin at position 24 or 28.

Subcellular localisation

Nucleus

Product protocols

Target data

The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.. The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.
See full target information MUC1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com