JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152364

Recombinant Human EMP2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human EMP2 protein is a Human Full Length protein, in the 1 to 167 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

XMP, EMP2, Epithelial membrane protein 2, EMP-2, Protein XMP

1 Images
SDS-PAGE - Recombinant Human EMP2 protein (AB152364)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human EMP2 protein (AB152364)

12.5% SDS-PAGE analysis of ab152364 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

P54851

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK","proteinLength":"Full Length","predictedMolecularWeight":"45.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":167,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P54851","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein epithelial membrane protein 2 (EMP2) also known as EMP2 or emp002 has a mass of approximately 20 kDa. EMP2 is expressed mainly in epithelial cells and certain tissues including the lungs breast and reproductive tissues. It appears on the cell surface where it modulates several cell processes. EMP2 plays a role in cell surface configuration by influencing the localization of other critical membrane proteins.
Biological function summary

EMP2 influences the cell's ability to undergo endocytosis a process important for nutrient uptake and signal transduction. It is part of a multiprotein complex that interacts with integrin and caveolin which are essential for cellular adhesion and signaling. EMP2 impacts cellular communication and growth emphasizing its role in maintaining cellular homeostasis.

Pathways

EMP2 is involved in the integrin-mediated pathway and the caveolae-mediated endocytosis pathway. It impacts integrin beta-1 (ITGB1) and c-Src kinase which are proteins important in cell signaling and mobility. These pathways facilitate various cellular functions including signal transmission and regulation of the cytoskeleton. EMP2's interaction with these pathways underlines its significance in cellular processes.

EMP2 has connections to lung cancer and endometriosis. Its altered expression influences disease progression and is associated with metastatic potential. EMP2 acts in concert with proteins such as β-catenin and fibronectin which contribute to cancer development and cellular invasiveness. Understanding EMP2's role offers insights into potential therapeutic targets for these conditions.

Specifications

Form

Liquid

General info

Function

Functions as a key regulator of cell membrane composition by regulating protein surface expression. Also, plays a role in regulation of processes including cell migration, cell proliferation, cell contraction and cell adhesion. Regulates transepithelial migration of neutrophils into the alveolar lumen, potentially via mediation of cell surface expression of adhesion markers and lipid raft formation (By similarity). Negatively regulates caveolae formation by reducing CAV1 expression and CAV1 amount by increasing lysosomal degradation (PubMed : 24814193). Facilitates surface trafficking and formation of lipid rafts bearing GPI-anchor proteins (By similarity). Regulates surface expression of MHC1 and ICAM1 proteins increasing susceptibility to T-cell mediated cytotoxicity (By similarity). Regulates the plasma membrane expression of the integrin heterodimers ITGA6-ITGB1, ITGA5-ITGB3 and ITGA5-ITGB1 resulting in modulation of cell-matrix adhesion (PubMed : 16216233). Also regulates many processes through PTK2. Regulates blood vessel endothelial cell migration and angiogenesis by regulating VEGF protein expression through PTK2 activation (PubMed : 23439602). Regulates cell migration and cell contraction through PTK2 and SRC activation (PubMed : 21637765, PubMed : 22728127). Regulates focal adhesion density, F-actin conformation and cell adhesion capacity through interaction with PTK2 (PubMed : 19494199). Positively regulates cell proliferation (PubMed : 24814193). Plays a role during cell death and cell blebbing (PubMed : 12107182). Promotes angiogenesis and vasculogenesis through induction of VEGFA via a HIF1A-dependent pathway (PubMed : 23334331). Also plays a role in embryo implantation by regulating surface trafficking of integrin heterodimer ITGA5-ITGB3 (PubMed : 16487956). Plays a role in placental angiogenesis and uterine natural killer cell regulation at the maternal-fetal placental interface, however not required in the maternal tissues for a viable pregnancy (By similarity). Involved in the early stages of embryogenic development and cardiogenesis, potentially via regulation of epithelial-mesenchymal transition timing (By similarity). May play a role in glomerular filtration (By similarity).

Sequence similarities

Belongs to the PMP-22/EMP/MP20 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Functions as a key regulator of cell membrane composition by regulating protein surface expression. Also, plays a role in regulation of processes including cell migration, cell proliferation, cell contraction and cell adhesion. Regulates transepithelial migration of neutrophils into the alveolar lumen, potentially via mediation of cell surface expression of adhesion markers and lipid raft formation (By similarity). Negatively regulates caveolae formation by reducing CAV1 expression and CAV1 amount by increasing lysosomal degradation (PubMed : 24814193). Facilitates surface trafficking and formation of lipid rafts bearing GPI-anchor proteins (By similarity). Regulates surface expression of MHC1 and ICAM1 proteins increasing susceptibility to T-cell mediated cytotoxicity (By similarity). Regulates the plasma membrane expression of the integrin heterodimers ITGA6-ITGB1, ITGA5-ITGB3 and ITGA5-ITGB1 resulting in modulation of cell-matrix adhesion (PubMed : 16216233). Also regulates many processes through PTK2. Regulates blood vessel endothelial cell migration and angiogenesis by regulating VEGF protein expression through PTK2 activation (PubMed : 23439602). Regulates cell migration and cell contraction through PTK2 and SRC activation (PubMed : 21637765, PubMed : 22728127). Regulates focal adhesion density, F-actin conformation and cell adhesion capacity through interaction with PTK2 (PubMed : 19494199). Positively regulates cell proliferation (PubMed : 24814193). Plays a role during cell death and cell blebbing (PubMed : 12107182). Promotes angiogenesis and vasculogenesis through induction of VEGFA via a HIF1A-dependent pathway (PubMed : 23334331). Also plays a role in embryo implantation by regulating surface trafficking of integrin heterodimer ITGA5-ITGB3 (PubMed : 16487956). Plays a role in placental angiogenesis and uterine natural killer cell regulation at the maternal-fetal placental interface, however not required in the maternal tissues for a viable pregnancy (By similarity). Involved in the early stages of embryogenic development and cardiogenesis, potentially via regulation of epithelial-mesenchymal transition timing (By similarity). May play a role in glomerular filtration (By similarity).
See full target information EMP2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com